KEGG   Sus scrofa (pig): 100155412
Entry
100155412         CDS       T01009                                 

Gene name
SUFU
Definition
(RefSeq) LOW QUALITY PROTEIN: suppressor of fused homolog
  KO
K06229  suppressor of fused
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04340  Hedgehog signaling pathway
ssc05200  Pathways in cancer
ssc05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100155412 (SUFU)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100155412 (SUFU)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100155412 (SUFU)
SSDB
Motif
Pfam: SUFU_C SUFU
Other DBs
NCBI-GeneID: 100155412
NCBI-ProteinID: XP_020928409
Ensembl: ENSSSCG00000010586
LinkDB
Position
14
AA seq 484 aa
MAELRPSGAPGPAAPPAPGPTXPPAFASLFPPGLHAIYGECRRLYPDQPNPLQVTAIVKY
WLGGPDPLDYVSMYRNXGSPSANIPEHWHYISFGLSDLYGDNRVHEFTGTDGPSGFGFEL
TFRLKRETGESAPPTWPAELMQGLARYVFQSENTFCSGDHVSWHSPLDNSESRIQHMLLT
EDPQMQPVQTPFGVVTFLQIVGVCTEELHAAQQWNGQGILELLRTVPVAGGPWLITDMRR
GETIFEIDPHLQERVDKGIESDGSNLSGVSAKCAWDDLSRPPEDDEDSRSICIGTQPRRL
SGKDTEQIRETLRRGLEINSKPVLPPINPQRQNGLTHDRAPSRKDSLESDSSTAIIPHEL
IRTRQLESVHLKFNQESGALIPLCLRGRLLHGRHFTYKSITGDMAITFVSTGVEGAFATE
EHPYAAHGPWLQILLTEEFVEKMLEDLEDLTSPEEFKLPKEYSWPEKKLKVSILPDVVFD
SPLH
NT seq 1455 nt   +upstreamnt  +downstreamnt
atggcggagttgcggcctagcggtgcccccggccccgctgcgcccccggcccctggccct
actngccctccggccttcgcctctctcttccccccgggactgcacgccatctacggagag
tgccgccgcctttaccctgaccagccgaacccgctccaggttaccgctatcgtcaagtac
tggttgggtggtccagaccccttggactatgttagcatgtacaggaacnatgggagccct
tctgccaacatccccgagcactggcactacatcagcttcggcctgagtgatctctatggc
gacaacagagtccatgaattcacaggaacagatggacctagtggttttggctttgagttg
acatttcgtctgaagagagaaacaggggagtctgcgcccccaacatggccagcagagcta
atgcaaggcttggccagatatgtgttccagtcagagaacaccttctgcagcggggaccac
gtgtcttggcacagccctttggataacagtgagtcaagaattcagcacatgctgctgaca
gaggacccgcagatgcagcccgtgcagaccccttttggggtggtgaccttcctccagatc
gttggcgtctgcaccgaggagctccacgcagcccagcagtggaacgggcagggcatcctg
gagctgctgaggacggtccccgtcgctggcggcccctggctgataactgacatgcggagg
ggagagaccatatttgagatcgatccacacctgcaagagagagttgacaaaggcatcgag
tcagacggctccaacctgagcggcgtcagcgccaagtgtgcctgggatgacctgagccga
cccccggaggacgatgaggacagccggagcatctgcatcggcactcagccccggcggctc
tccggcaaagacacggagcagatccgggagaccctgaggagagggcttgagatcaacagc
aaacctgtccttccgccaatcaaccctcagcggcagaatggcctcacccacgaccgggcc
ccgagccgcaaagacagcctggaaagcgacagctccacggccattattccccatgagctg
atccgcacacggcagctcgagagtgtacatctgaaattcaaccaggagtcgggagccctc
attcctctttgcctcaggggcaggctcctgcacggacggcactttacgtataaaagtatc
acaggtgacatggccatcacctttgtctccacgggagtagaaggcgcctttgccactgag
gagcacccttatgcagctcatggaccctggttacaaattctattgactgaagagtttgta
gagaaaatgttggaggacttagaagatttgacttctccagaggaattcaagcttcccaaa
gagtacagctggcccgagaagaagctcaaagtctccatcctccccgacgtggtcttcgac
agtccactgcactag

DBGET integrated database retrieval system