KEGG   Sus scrofa (pig): 100155449
Entry
100155449         CDS       T01009                                 

Gene name
RUNX1T1
Definition
(RefSeq) LOW QUALITY PROTEIN: protein CBFA2T1
  KO
K10053  CBFA2/RNUX1 translocation partner 1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100155449 (RUNX1T1)
   05202 Transcriptional misregulation in cancer
    100155449 (RUNX1T1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100155449 (RUNX1T1)
SSDB
Motif
Pfam: NHR2 TAFH zf-MYND DUF3731 Efg1 MAJIN
Other DBs
NCBI-GeneID: 100155449
NCBI-ProteinID: XP_020944782
Ensembl: ENSSSCG00000006115
LinkDB
Position
4
AA seq 663 aa
MCHPDKPFTSDKLRCVFNEYKATVWVPPRLRPLSCAPLPEAGGENLHLKISRGRKRNLPF
VVWGEEEASXPGLAVISHHLCYPDRTHGDRTEKHSTMPDSPVDVKTPSRLTPPTMPPPPT
TQGAPRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGAR
QLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFV
IPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENGK
RRTPDRTKENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYR
LDDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLL
NCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAEDLKKGGSSSSSHSRQQSPVNP
DPVALDAHREFLHRPASGYVPEEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITS
ERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQH
KDWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPMDTPPAATPRSTTPGTPSTIET
TPR
NT seq 1992 nt   +upstreamnt  +downstreamnt
atgtgccatcctgacaagccttttacttctgataagctccgatgtgtgtttaatgaatac
aaagccacggtctgggtgccgcctcggctgcggccgctctcctgcgctcctttgccagaa
gctggcggagagaatttacatttaaagattagcagagggagaaagcgaaatctgcctttt
gttgtgtggggtgaggaggaggcatcangtcctggcctggccgttatctcccatcacctc
tgctatccagacaggactcacggagatcggactgagaagcactccacaatgccagactca
cctgtggatgtgaagaccccgtccaggctgacccctcccacgatgccacctcccccgaca
actcaaggagctcccagaaccagttcatttacaccaacaacgttaaccaatggcacgagc
cattcgcctacagccttgaatggcgccccctcgccgcccaatggctttagcaatgggccc
tcctcttcttcttcctcttctctggcaaatcaacagctgcccccagcctgtggcgccagg
cagctcagtaagctgaaacggttcctcactaccttgcagcagtttggcaatgacatttca
ccagagataggagagcgagtgcgcaccctcgtactaggactggtgaactctactttgaca
attgaagaatttcattctaaactgcaagaagctacgaacttcccactgcgaccttttgtc
atcccatttttgaaggccaacttgcccctgctgcagcgcgagctcctccactgcgcaagg
ctggccaaacagaaccctgcccagtacctcgcccagcatgaacagctgcttctggatgcc
agcaccacctcacctgttgactcctcagagctgcttctcgatgtgaacgaaaacgggaag
aggcgaactccagacagaaccaaagaaaatggctttgacagagagcctttgcactcagaa
catccaagcaagcgaccatgcactattagcccaggccagcggtacagtccaaataacggc
ttgtcctaccagcccaatggcctgcctcaccccacccctcctccacctcagcattaccgt
ttggatgatatggccattgcccaccactacagggactcctatcgacaccccagccacagg
gacctcagggacagaaacagacctatggggttgcatggcacacgtcaagaagaaatgatt
gatcacagactaacagaccgagaatgggcagaggaatggaaacatcttgaccatctgtta
aactgcataatggacatggtagaaaaaacaaggcgatctctcactgtactaaggcgatgt
caggaagcagatcgggaggaactgaattactggatccggcggtacagtgatgccgaggac
ttaaaaaagggcggcagcagtagcagcagtcactccaggcagcagagtcctgtcaaccca
gacccagttgcattagatgcgcatcgggaattccttcacaggcctgcttctggatatgtg
ccagaggagatctggaagaaagctgaggaggcggtcaatgaggtgaagcgccaggcgatg
accgagctgcagaaggccgtgtcagaggccgagcggaaagcacacgacatgatcacctcg
gagcgtgcaaagatggagcgcacggtggccgaggccaagcggcaggcagcagaggacgcc
ctagccgttatcaaccagcaggaagattcaagcgagagttgctggaattgtggccgtaaa
gcaagtgaaacctgcagcggctgtaacacagcccgatactgtggctcgttttgccagcac
aaagactgggagaagcaccaccacatctgtggacagaccctgcaagcccagcagcagggg
gacacgcctgctgtcagctcctccgtcacacccaacagtggggccgggagcccaatggac
acaccaccagcagccaccccgaggtcaaccaccccgggaaccccttccaccatagagaca
acccctcgctag

KEGG   Sus scrofa (pig): 100512633
Entry
100512633         CDS       T01009                                 

Gene name
RUNX1
Definition
(RefSeq) runt-related transcription factor 1
  KO
K08367  runt-related transcription factor 1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04530  Tight junction
ssc04659  Th17 cell differentiation
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05220  Chronic myeloid leukemia
ssc05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100512633 (RUNX1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100512633 (RUNX1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100512633 (RUNX1)
   05202 Transcriptional misregulation in cancer
    100512633 (RUNX1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100512633 (RUNX1)
   05220 Chronic myeloid leukemia
    100512633 (RUNX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    100512633 (RUNX1)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Runt
    100512633 (RUNX1)
SSDB
Motif
Pfam: Runt RunxI DUF3037
Other DBs
NCBI-GeneID: 100512633
NCBI-ProteinID: NP_001233181
Ensembl: ENSSSCG00000012051
UniProt: F8SIP5 A0A4X1TP86
LinkDB
Position
13
AA seq 480 aa
MASDSIFESFPSYSQCFMRECVHGMNPPRDVHDASTSRRFTPPSTALSPGKMSEALPLGA
PDASAALAGKLRSGDRSMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVA
LGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVF
TNPPQVATYHRAIKITVDGPREPRRHRQKLDDQPKPGSLSFSERLSELEQLRRTAMRVSP
HHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPAT
PISPGRASGMTTLSAELSSRLSSAPDLTAFGDPRQFPALPSISDPRMHYPGAFTYSPTPV
TSGIGIGMSAMSSATRYHTYLPPPYPGSSQAQGGPFQASSPSYHLYYGASAGSYQFSMVG
GERSPPRILPPCTNASTGSALLNPSLPNQSDVVEAEGSHSNSPTNMAPAARLEEAVWRPY
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggcttcagacagcatatttgagtcatttccttcatactcacagtgcttcatgagagaa
tgtgtacacggaatgaatccacctagagatgtccacgatgccagcacgagccgccgcttc
acgccgccttccaccgcgctgagcccgggcaagatgagcgaggcgctgccgctgggcgcc
ccggacgccagcgccgccctggccggcaagctgaggagcggcgaccgcagcatggtggag
gtgctggccgaccaccccggcgagctggtgcgcaccgacagtcccaacttcctctgctct
gtgctgcccacgcactggcgctgcaacaagaccctgcccatcgctttcaaggtggtggct
ctgggggacgttccagatggcactctggtcactgtgatggcaggcaatgacgaaaactac
tcagctgaactgagaaatgcaactgcagccatgaaaaaccaagttgcaagattcaatgac
ctcaggtttgtcggtcggagtggaagagggaaaagcttcactctgacaatcaccgtcttc
acaaacccaccgcaagtcgccacctaccacagagccatcaaaatcacagtggatggacct
cgtgaacctcgaagacatcgtcagaaactagatgatcagcccaagcccgggagcttgtcc
ttttccgagcggctcagtgaactggagcagctgcggcgcacggccatgagggtcagccca
caccacccagcccccacacccaaccctcgggcctccttgaaccactccactgcctttaac
cctcagcctcagagtcagatgcaggacacaaggcagatccagccatccccaccatggtcc
tacgatcagtcctaccaatacctgggatccattgcctctccttctgtccacccagcaact
cccatctcgcctggacgggccagcggcatgacaaccctctctgcagagctttccagtcga
ctctcaagtgcacctgacctgacggcctttggcgacccgcgccagttccccgcgctgccc
tccatctctgacccccgcatgcactaccccggcgccttcacctactccccgacgcccgtc
acgtcgggcatcggcatcggcatgtcggccatgagctcggccacgcgctatcacacgtac
ctgccaccgccctaccccggctcgtcgcaggcacagggcggcccgttccaggccagctcg
ccgtcctaccacctctactacggcgcgtcagctggctcctaccagttctccatggtaggc
ggcgaacgctcgccgccgcgcatcttgccgccctgcaccaacgcctccaccggctcggca
ctgctcaaccccagcctcccaaaccagagcgacgtggtggaggctgagggcagccacagc
aactcccccaccaacatggcgcctgccgcgcgtctcgaagaggccgtatggcggccctac
tga

DBGET integrated database retrieval system