KEGG   Sus scrofa (pig): 100155891Help
Entry
100155891         CDS       T01009                                 

Gene name
LIG4
Definition
(RefSeq) DNA ligase 4
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    100155891 (LIG4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ssc03400]
    100155891 (LIG4)
Enzymes [BR:ssc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100155891 (LIG4)
DNA repair and recombination proteins [BR:ssc03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     100155891 (LIG4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_IV BRCT BRCT_2 RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 100155891
NCBI-ProteinID: XP_003131137
Ensembl: ENSSSCG00000009540
UniProt: F1RLP1
LinkDB All DBs
Position
11
AA seq 910 aa AA seqDB search
MAASQASKTVASHVPFADLCSTLERIQRSRGRGEKMRHFKEFLDSWRKFHDALHKNHRDV
TDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPRDGKDALKLLNYRTPTGTRG
DAGDFAIIAYFVLKPRCLQKGSLTIQQVNDLLDSIASNNSAKRKDLVKKSLLQLITQSSA
LEQKWLIRMILKDLKLGFSQQTIFSLFHDDAAELHNVTTDLEKVCRQLHDPSVGLSDISI
TLFSAFKPMLAAIADIERIEKDMKHQSFYIETKLDGERMQMHKDGDVYQYFSRNGYNYGD
QFGVSPQEGSLTPFIHGTFKTNVQNCILDGEMMAYNPNTQTFMQKGNKFDIKRMVEDSDL
QTCYCVFDVLMVNSKKLGHETLKNRYEILSSVFTPIPGRIEIVPKTQAHTKKEVIDALNE
AIDKREEGIMIKYPLSIYKPDKRGEGWLKIKPEYVNGLMDELDILIVGGYWGKGARGGMM
SHFLCAVAEKPPAGEKPSVFHTLCRVGSGYTMKELYDLGLKLAKHWKPFHRKAPPGSILC
GTEKPEVYIEPCNSVIVQVKAAEIVPSDMYKTGCTLRFPRIEKIREDKEWHECTTLDDLE
HLRGKAAGKLASKHLYVGDEEPQEKKRKAAPKAKKVIGIIEHLKAPNLSNINKVSNMFED
VEFCVMTGSDSHPKPDLESRIAEFGGYIVQNPGPDTYCVIAGSENIRVRNIISSNKHDVV
KPEWLLECFRTQRCAPWQPRFMVHMCPSTKQHFARQYDCHGDSYFVDTDVNQLKEVFSGI
KTPGEQTPREMAPVIADLEHRYAWDRAPLSMFRPHTVYPDLYAVINDPSTKIEGTRLAIT
ALELQFHGAEVVSHLAEGVSHVIIGEDHSRLADLKAFRRTLKRKFKILPERWAIESIDKC
ELQEENQYWV
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atggctgcctcacaagcttcaaaaactgttgcatctcacgtcccttttgcagacttatgt
tcaactttggaacgaatacagagaagtagaggacgtggagaaaaaatgagacacttcaaa
gaatttttagattcttggcgaaaatttcatgatgcccttcacaagaaccacagagatgtc
acagactctttctatccagccatgagactcattcttcctcagctggaaagagagagaatg
gcttatggaatcaaagaaactatgcttgctaagctttacatcgaattgcttaacctaccc
cgagatggaaaagatgccctgaagcttctaaattaccgaacacctaccggaactcgcgga
gacgccggagattttgccatcattgcgtactttgtgttgaaacccagatgtttacagaaa
ggcagtttaaccatccagcaagtgaacgaccttttagactccattgccagcaataattct
gccaaaaggaaggatctggtcaaaaagagtcttcttcagctcataacccagagttcagcc
cttgaacaaaagtggctgatccggatgattttaaaggacttaaagcttggatttagtcag
caaactatattttctctttttcacgatgatgctgctgagttgcataacgtcaccacagat
ctggagaaggtctgcaggcaactgcatgatccttcggtgggactcagtgacatttccatc
actttattctctgccttcaagccaatgctggccgctatcgcagacattgagcgaattgag
aaggacatgaaacaccagagtttctacatcgaaaccaagctagacggcgaacgtatgcaa
atgcacaaagacggggacgtgtatcagtacttctcccgaaacggatacaactatggggac
cagtttggagtttccccacaggaagggtcccttaccccgttcattcatggcacattcaaa
acaaatgtccaaaactgcatccttgatggtgagatgatggcctacaatccgaacacgcag
acctttatgcagaaggggaataagtttgatattaaaaggatggtagaagattccgacctg
cagacttgttactgtgttttcgatgtgttgatggttaatagcaaaaagctaggacacgag
accctgaagaataggtatgaaattcttagtagtgtctttacgcccataccaggtagaata
gaaatagtgccgaaaacacaggctcacactaagaaagaagtaattgatgctttgaacgaa
gccatagataaaagagaggaggggatcatgatcaaatatcctctgtccatctacaagcca
gacaaaagaggcgaaggatggttaaaaattaagccggagtatgtcaacggactgatggat
gagctggacatcttaatcgtcgggggctactgggggaaaggtgcccggggtggaatgatg
tctcattttttgtgtgctgtggccgagaagccccccgccggtgaaaaaccctcagtgttc
cataccctctgccgcgtgggctcaggctacaccatgaaagaactgtatgacctgggcttg
aaactggccaaacactggaagccctttcataggaaagctccaccaggaagcattttatgt
ggaacagagaagccagaggtgtacatcgagccttgcaattcagtcatcgttcaggttaag
gcggcagagatcgtccccagtgatatgtacaaaactggctgcacgttgcgcttcccacgc
atcgaaaagataagagaagacaaagaatggcatgagtgcacgaccctggatgacctggaa
caccttcgagggaaagcggccggaaagctcgcgtccaagcacctttacgtaggtgacgag
gaaccccaagagaaaaagcggaaagccgccccaaaggctaagaaggtcattggaatcatc
gagcacctcaaagcgcctaacctttccaacatcaacaaggtctctaacatgtttgaggac
gtggagttttgcgtcatgactggaagcgacagccatcccaagcctgacctggagagcaga
atcgcagagtttgggggttacatagtacagaatccgggccccgacacatactgcgtgatc
gcagggtctgagaacatccgcgtgagaaacatcatctcttcaaataagcacgacgtcgtc
aagcccgagtggctcctcgagtgtttcaggacccagcgctgtgcgccctggcagcctcgc
ttcatggttcacatgtgcccgtccaccaaacagcactttgcccggcaatatgactgccat
ggcgacagctactttgtcgacacagacgtgaaccaactgaaggaagtgttctcaggaatt
aaaactccgggggaacagacgccccgggagatggctcctgtgatcgccgacttggaacac
cgctatgcctgggacagggctcctctcagcatgtttcgaccccacactgtgtatcccgac
ttgtatgcagtgattaacgacccgagtaccaaaatcgagggaacgagattggccatcacg
gccttggagcttcagtttcatggggcagaagtagtgtctcatttggccgagggagtgtct
cacgtcatcattggcgaagatcacagtcggcttgcagacttgaaagcttttcgaagaact
cttaagagaaagtttaaaatcctcccagagcgttgggccattgagtcaatagacaagtgt
gaattacaggaggaaaatcaatattgggtttaa

DBGET integrated database retrieval system