KEGG   Sus scrofa (pig): 100156017
Entry
100156017         CDS       T01009                                 

Gene name
CCNA1
Definition
(RefSeq) cyclin-A1
  KO
K06627  cyclin-A
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04110  Cell cycle
ssc04152  AMPK signaling pathway
ssc04218  Cellular senescence
ssc04914  Progesterone-mediated oocyte maturation
ssc05161  Hepatitis B
ssc05165  Human papillomavirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05169  Epstein-Barr virus infection
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05203  Viral carcinogenesis
ssc05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100156017 (CCNA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100156017 (CCNA1)
   04218 Cellular senescence
    100156017 (CCNA1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100156017 (CCNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100156017 (CCNA1)
   05202 Transcriptional misregulation in cancer
    100156017 (CCNA1)
   05203 Viral carcinogenesis
    100156017 (CCNA1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100156017 (CCNA1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100156017 (CCNA1)
   05161 Hepatitis B
    100156017 (CCNA1)
   05169 Epstein-Barr virus infection
    100156017 (CCNA1)
   05165 Human papillomavirus infection
    100156017 (CCNA1)
DNA replication proteins [BR:ssc03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100156017 (CCNA1)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100156017 (CCNA1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Cyclin_N2
Other DBs
NCBI-GeneID: 100156017
NCBI-ProteinID: XP_005668396
Ensembl: ENSSSCG00000009354
UniProt: F1RSR0
LinkDB
Position
11
AA seq 421 aa
MHLSSSKSGRVLAPVSGGPDACQMMSRAQLSQDPPQRTVLGVLTENGQYRRTCGQEITAL
RCFSGSENVLPPAGKKVLSDSGVQAPAKQGFDIYMDEPEQGDRDSCAGREGMAFEDAYEV
DTSTFKSDLHFLLDFNTVSPMLVDSSLYSQSEDASDFGTDVINVTEYAEEIHQYLREAEM
RYRPKAHYMRKQPDITEGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRG
KLQLVGTAAILLASKYEEIYPPEVDEFVYITDDTYTKRQLLRMEHLLLKVLAFNLTAPTT
NQFLLQYLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAYCLANYTVNRHFW
PEALATFTGYSLSEIVPCLSELHKACLGIPHRPQQAIREKYKASKYMHVSLMEPPAVLPL
Q
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgcatctcagtagctccaagagcgggagagtgctggctccagtgtccggaggtcctgat
gcctgtcagatgatgtccagagcccagctcagccaggatccaccacaaagaacagtacta
ggggtgctaaccgagaatgggcaatacaggaggacctgtggccaggagatcacagcactc
aggtgtttctctggatccgaaaatgtcctccctccagccggaaagaaggtgctctctgac
agcggggttcaggcaccagccaagcaaggatttgacatctacatggatgagcccgagcag
ggggacagagacagctgcgcagggagagaggggatggcatttgaggatgcctatgaagta
gacaccagcacattcaagtcagaccttcacttcctgttggactttaacacagtttcccct
atgctggtagattcatctctctactcccagtctgaagatgcatcagattttggtacagat
gtgataaatgtgactgaatatgctgaagaaattcatcagtaccttagagaagctgaaatg
agataccggcctaaagcgcactacatgaggaaacaaccagatatcacagaaggcatgcga
acgattctggtggactggctggttgaggttggagaagaatataagcttcgggcagagacc
ctctacctggccgtcaacttcctggacaggtttctctcgtgcatgtctgttctgagaggg
aagctgcagcttgtaggaacagcagctattctcctggcttcgaaatatgaggaaatatat
ccacctgaagtagacgagtttgtctacataactgatgacacttacacaaaacgacagctg
ctgagaatggaacacctgctcctgaaggtcctggctttcaatctgacggcaccaaccact
aaccagtttctccttcagtacctaagaagacagggtgtgtgtgtcaggactgagaacctg
gccaagtacgtagcagaattgagtctccttgaagctgacccgttcttgaaatatcttcct
tcactgatagctgcagctgcttattgtctggcaaattatactgtgaacaggcacttctgg
ccagaagcccttgctacgttcacaggctattcactgagtgaaattgtgccttgcctgagt
gagctgcataaagcctgccttggtataccccaccgacctcaacaagcaattagggagaag
tataaggcttcaaagtacatgcatgtgtctctcatggaaccacccgcagtccttcctcta
caataa

KEGG   Sus scrofa (pig): 100415929
Entry
100415929         CDS       T01009                                 

Gene name
CCNA2
Definition
(RefSeq) cyclin-A2
  KO
K06627  cyclin-A
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04110  Cell cycle
ssc04152  AMPK signaling pathway
ssc04218  Cellular senescence
ssc04914  Progesterone-mediated oocyte maturation
ssc05161  Hepatitis B
ssc05165  Human papillomavirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05169  Epstein-Barr virus infection
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05203  Viral carcinogenesis
ssc05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100415929 (CCNA2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100415929 (CCNA2)
   04218 Cellular senescence
    100415929 (CCNA2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100415929 (CCNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100415929 (CCNA2)
   05202 Transcriptional misregulation in cancer
    100415929 (CCNA2)
   05203 Viral carcinogenesis
    100415929 (CCNA2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100415929 (CCNA2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100415929 (CCNA2)
   05161 Hepatitis B
    100415929 (CCNA2)
   05169 Epstein-Barr virus infection
    100415929 (CCNA2)
   05165 Human papillomavirus infection
    100415929 (CCNA2)
DNA replication proteins [BR:ssc03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100415929 (CCNA2)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100415929 (CCNA2)
SSDB
Motif
Pfam: Cyclin_N2 Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100415929
NCBI-ProteinID: NP_001171397
Ensembl: ENSSSCG00000009094
UniProt: D5HP13
LinkDB
Position
8
AA seq 432 aa
MLGSSAPGPVAREAGSALLTLQQTALQEDQENINPEKAAAAQQPRTRAGLAVLKAGNSRG
PALQQRPKTRRVAPLKDLPINDEHVTVPPWKANSKQPAFTIHVDEAEEETQKRPAESKKP
ESEDVLAFNSAVTLPGPRKPLVPLDYPMDGSFESPHTMDMSIVLEDEKPVSVNEVPDYHE
DIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYID
RFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLK
VLAFDLAAPTINQFLTQYFLHQQSANCKVESLAMFLGELSLIDADPYLKYLPSVTAAAAF
HLALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHG
VSLLNPPETLNI
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgttgggcagctccgcgcccgggcctgtggcccgcgaggcgggctcggcgttgctaaca
ttgcagcagacggcgctccaagaggaccaagagaacatcaaccccgagaaggctgcggcc
gcccagcagccccggacccgggctgggctggcggtactgaaggccgggaactcacggggt
ccagcgctgcagcagaggcctaagacgcgacgggttgcgcctcttaaggatcttcctata
aatgatgagcatgtcactgttcctccttggaaagcaaacagtaaacaacctgcatttacc
attcatgtggatgaagcagaagaagagactcaaaagaggccagctgaatctaaaaaacca
gaaagtgaagatgtcctggcttttaattcagctgttactttacctggaccaagaaaacca
ctggtacctcttgattacccaatggatggtagttttgagtcaccacatactatggacatg
tcaattgtattggaagatgaaaagccagtgagtgttaatgaagttccagactaccatgag
gacattcacacataccttagggaaatggaggttaaatgtaagcctaaagtgggttacatg
aagaaacagccagacattactaacagtatgagggctatcctcgtggactggttagttgaa
gtaggagaagaatataaactacagaatgagaccctgcatttggctgtgaactacattgat
aggtttctttcatcgatgtctgtgttgagaggaaaacttcagcttgtgggcactgctgct
atgctgttggcctcaaaatttgaagaaatatatcccccagaagtagcggagtttgtatac
attacagatgacacttatactaagaaacaagttttgagaatggagcacctcgttttgaaa
gtccttgcttttgacttagctgcaccaacaataaatcagtttcttacccagtactttctg
caccagcagtctgcaaactgcaaagttgaaagtttagccatgtttttgggagagttaagt
ttgatagatgctgacccgtacctaaagtatttgccatcagttactgctgcagcagccttt
catttagcactctacacagtcacgggacaaagctggcctgaatcattagtacaaaagact
ggatatacgctggaaacgcttaagccttgtctcctggaccttcaccagacctacctcaga
gcaccacagcatgcacaacagtcaataagagagaaatacaaaaattccaagtatcatggt
gtttctctcctcaacccaccagagacactaaatatttaa

DBGET integrated database retrieval system