KEGG   Sus scrofa (pig): 100156137Help
Entry
100156137         CDS       T01009                                 

Gene name
SETD1B
Definition
(RefSeq) LOW QUALITY PROTEIN: histone-lysine N-methyltransferase SETD1B
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ssc00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100156137 (SETD1B)
Enzymes [BR:ssc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100156137 (SETD1B)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100156137 (SETD1B)
   HMT complexes
    COMPASS/SET1 complex
     100156137 (SETD1B)
    COMPASS/SET1 complex (yeast)
     100156137 (SETD1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1 RRM_5
Motif
Other DBs
NCBI-GeneID: 100156137
NCBI-ProteinID: XP_020928890
Ensembl: ENSSSCG00000009806
LinkDB All DBs
Position
14
AA seq 1971 aa AA seqDB search
MENSHPPHHHHQQPPPQPGPSGERRNHHWRSYKLMIDPALKKGHHKLYRYDGQHFSLAMS
SNRPVEIVEDPRVVGIWTKNKELELSVPKFKIDEFYVGPVPPKQVTFAKLNDNIRENFLR
DMCKKYGEVEEVEILYNPKTKKHLGIAKVVFATVRGAKEAVQHLHSTSVMGNIIHVELDT
KGETRMRFYELLVTGRYTPQTLPVGELDAVSPIVNETLQLSDALKRLKDGGLSTGCGSGS
SSVTPNSGGTPFSQDTAYSSCRLDTPNSYGQGTPLTPRLGTPFSQDSSYSSRQPTPSYLF
SQDPTATFKARRHESKFTDAYNRRHEHHYVHNSSSVPAVAGATATFRGSVDLPFGAVGGS
GGSGGPPFKAQPQDSATFAHTPPPTQATPTPGVAFKSAFSPYQTPVPPFPPPPEEPAATT
PFGARDSGEFRRAPAPPPPPPTEPLTKEKPGTPPGPPPPDTNSMELGGRPTFGWSPEPCD
SPGTPTLESSPAGPEKPHDSLDSRIEMLLKEQRTKLPFLREQDSDTELQMEGSPISSSSS
QLSPLAPFGTNSQPGFRGPTPPSSRPSSTGLEDISPTPLPDSDEDDELDLGLGPRPPPEP
GPPDPTGLLGQTTEVALDLAGDRTPTSEKMDEGQQSSGEDMEISDDEMPSAPITSADCPK
PMVVTPGAGAVAAPSVLAPTLPLPPPPGFPPLPPPPPPPPPQPGFPMPPPLPPPPXPPPP
AHPAVTVPPPPLPAPPPGVPPPPILPPLPPFPPGLFPVMQVDMSHVLGGQWGGMPMSFQM
QTQMLSRLMTGQGACPYPPFMAAAAAAASAGLQFVNLPPYRGPFSLSNTGPGRGQPWPPL
PKFDPSVPPPGYVPRQEDPHKATVDGVLLVVLKELKAIMKRDLNRKMVEVVAFRAFDEWW
DKKERMAKASLTPVKSGEHKDEDRPKPKDRIASCLLESWGKGEGLGYEGLGLGIGLRGAI
RLPSFKVKRKEPPDTASSGDQKRLRPSTSVDEEDEESERERDRDMADAPCELPKRDPKAV
GVRRRPARPLELDSGGEEDEKESLSVSSSSSVSSSSGSSTTSPSSSASDKEERESTEEEE
DEEGEEEEEEEGEGPRSQVSSSSTSSTSDKDEDDEDSDDRDESDNDEEDTALSEASEKEE
GDSDGEETVSITTSKPGAESSSESSESSDFESSSESSSSSSEDEEELTAGEEDEEEEEDE
DEEEEEAAADESMAPAAPDEDFEEVMAMGAAAVGPEEEVDIEAEGEAPEERAPMLEEPSL
PVGVEDLAGCKEPPEEPGLNEQVAGLPSPEPAAGEMEARPLPSPELTQEDKLEAEPAPPT
LLSLPLQPPLPPPRLPRPPSPPPEPETTDLPHPAVPLEPPHEDQPPRTPSLCGSLAKSQS
AEAVPATPSGEPLPLGGGSSLPLSSPQLPGSPFSYPSPSPGLSSGGLPRTPGRDFSFTPT
FPEPGGPLLLPVCPLPAGRRDERSGPLASPVLLETGLPLPLPLPLPLPLALPVPVLRAQT
RAPTQLPPLLPAPLAPCPPPIKRKPGRPRRSPPAVLSLDGPLVRPPGGATLGRDLLLLPG
QPQTPVFPSTHDPRTVTLDFRNAGIPAPPPPLPPXPPPPPPPPPVEPTKLPFKELENQWP
SEAILSGPRGRDEVTQEFMDLHKVRGPWRRPPKKRHEDLVASVSPELSPPQPLFRPRTEF
EEMTILYDIWNGGIDEEDIRFLCVTYERLLQQDNGMDWLNDTLWVYHPSTSLSSAKKKKR
DDGIREHVTGCARSEGFYTIDKKDKLRYLNSSRASTDEPPTDTQGMSIPAQPHASTRAGS
ERRSEQRRLLSSFTGSCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLFAMEPIAADEMVIE
YVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAK
VITVESQKKIVIYSKQHINVNEEITYDYKFPIEDVKIPCLCGSENCRGTLN
NT seq 5916 nt NT seq  +upstreamnt  +downstreamnt
atggagaacagtcaccccccccaccaccaccaccagcagcccccgccgcagcccggccct
tcgggcgagaggaggaaccaccattggagaagttacaagttgatgattgacccggctttg
aaaaaggggcatcataaactgtatcgctacgatgggcagcatttcagcctggcgatgtcc
agcaaccgccctgtggaaattgtcgaagatccccgggtcgtcgggatctggaccaaaaac
aaggagttggagctttcggtgcctaaattcaagatcgatgagttctacgtgggcccagtg
cctccgaagcaggtgacatttgccaagctgaatgataacatccgtgaaaacttcctgagg
gacatgtgcaagaagtatggggaggtggaggaggtggagattttgtacaaccccaagacc
aagaagcacttgggcattgccaaagtggtctttgccacggtcaggggagccaaggaggcg
gttcagcacttgcatagcacttcagtcatgggcaatatcatccacgtggagctggacacc
aaaggggaaacccgcatgcggttctacgaactgttggtcacgggccgatacacaccccaa
accctcccagtgggagagctggacgccgtctctccaatcgtgaatgagaccctacagcta
tcagatgctctgaagcgcctcaaagatggtggcctgtctacaggttgtggctctggctca
tcctctgtcacccccaatagtggtgggacccccttctcccaggacactgcttactctagc
tgccgcctggacacacccaattcctatggacaaggaacgccgctcaccccgcgcctgggc
acccccttctcgcaggactctagctactccagccgtcagcccacaccctcctacctcttc
agccaggaccccactgcaaccttcaaggcccggcgccatgagagcaagttcacagatgcc
tacaaccgccgccacgaacaccattatgtccacaactcttcctcagtccctgcagtggca
ggggccacagccacctttaggggctcagtggacctcccatttggggcagttggcggcagc
gggggcagcgggggccctccattcaaggcccagccacaggattcagccacgtttgcccac
actccaccaccgacccaagccacccccactcctggagtcgcattcaagtcggctttctct
ccctatcagacgcccgtgcccccttttcccccaccccctgaggaacccgctgccaccacc
ccctttggggcccgtgacagcggggagttccggagagcacctgcgcccccaccgccacca
cccaccgagcccctgaccaaggagaagccaggcacgccacccggccccccaccccctgac
accaacagcatggagctgggcggccggccgaccttcggctggagtcctgaaccctgtgac
agtcccggcacgcccacactggaatcgtcacctgcagggccagagaagccccacgacagc
ctggactcacgcatcgagatgctgctgaaggagcagcgcactaagctgcccttccttcgg
gagcaggactcggacacggagctgcagatggagggcagtcctatctcctcctcctcctcc
cagctctctccgctggcccccttcggcactaactctcagcctggcttccgaggccccaca
ccgccctcctcacgcccctccagcactggcctggaggatatcagtcccacaccactgcct
gactcggatgaggatgatgagcttgacctgggcctgggaccccggcccccaccggagcca
ggccccccggaccctactggtcttctgggtcagacaactgaggtggccttggacctggct
ggagacaggaccccaacctcagagaagatggatgaggggcaacagtcctcaggggaggac
atggagatctcagacgacgagatgccctcagcccccatcaccagcgctgactgccccaag
cccatggtggtgaccccaggggcaggagctgtggcagctccctctgtgctggccccgacc
ctgccactgcctccaccccctggcttcccaccactgcccccacccccaccaccgcctcca
ccccaacctggcttccccatgcccccacctcttccgcccccaccgncccccccaccccca
gcccacccagctgtgacagtgcccccaccacctctgccagcaccaccacctggggtccca
cccccgcccattctgccaccactgccacccttcccaccagggctgttccctgtgatgcag
gtggacatgagccacgtgctgggtggccagtggggcggcatgcccatgtccttccagatg
caaacgcagatgctgagccggctgatgacaggccagggcgcttgtccctacccacccttc
atggctgcagcagccgcagctgcctctgctgggctacagtttgtcaacctgccaccctac
cggggccccttctccctgagcaacactggccctggccgtgggcagccctggcctcccctg
cctaaattcgacccatcagtgccgccaccaggctacgtgccacgccaggaggacccacac
aaggccactgtggatggtgtcctgctggtggttctcaaagagctcaaggccatcatgaag
cgggacctgaaccgcaagatggtggaggtggtggccttccgggcattcgatgagtggtgg
gacaagaaggagcggatggccaaggcctcgctgaccccggtcaagtcaggcgagcacaag
gatgaggacaggccgaagcccaaggaccgcatcgcctcctgcctgctggagtcatggggc
aagggcgagggcctgggctacgagggcctgggcctgggcatcgggctgcgcggggccatc
cgcctgccctccttcaaggtcaagaggaaggagccgcctgacacagcgtcatcaggtgac
cagaagcggttgagaccctcgacctcagtggatgaggaagatgaagagtccgagcgtgag
cgggaccgggacatggcggacgccccctgcgagctccccaagcgagaccccaaggctgtg
ggtgtgcggcgacggccagcccggccactggagctggacagtggtggggaagaggacgag
aaggagtcgctgtcagtgtcctcatcgtcatcggtgtcctcgtcttccgggtcgtcaaca
acctcaccctcatcctcagcctctgacaaggaagaacgagaaagcactgaggaggaggag
gacgaggagggggaggaggaggaggaggaggagggagagggacccaggagccaggtctct
tcctcctcaacctcatctacgtcagataaggatgaagatgatgaggacagcgatgaccgg
gatgagtctgacaatgatgaggaggacacagccctgtcggaggccagtgagaaggaagag
ggggactcggatggagaggagacagtgagcatcaccacctccaagcctggagccgagtcc
tccagtgagagttctgagtcttctgacttcgaatcaagctctgagtcctcatcatcatcc
tcggaggatgaagaagagctgacagcaggggaggaggatgaagaggaggaggaagacgag
gacgaggaggaggaggaggcagctgcagatgagagcatggctcctgctgctcctgacgag
gactttgaggaggttatggctatgggggcagccgcagtgggcccggaagaggaggtggac
atcgaggctgagggtgaagctcctgaggagcgggcccccatgctggaagagccctccttg
cctgtgggggtcgaggatctggctggctgcaaggagccccctgaggagccaggcctgaat
gagcaagtggctgggttgccctctccagaacctgctgcgggagagatggaagcccggccc
ctgccatccccggagctcacccaagaggacaagttggaagcggaacctgcgcccccgacg
ctgctctccttacctctgcagccaccattgccgccccctcggctgccccggccacccagc
ccaccaccagagcccgagaccacagacctcccacacccagcggtccctctggagcctcct
catgaggaccagcccccacgtactccgagcctctgtggcagcctggccaagtcgcagagt
gcagaggcggtgccggccacgccaagcggggagcccctgccattggggggtggcagcagc
ctgcccctgagctccccgcagctgccaggcagtcccttctcctacccatccccgtcccct
ggcttgagcagtgggggcctcccaaggacacctggccgggacttcagcttcacacctacc
ttccccgagccgggtgggcccctccttctacctgtctgtcccctcccagctggccggcgt
gatgagcggtctggccccctggcttcgccggtgctcctggagacgggcctgccgctccct
ctgcccttgcccttgcccctgcctttggcattgcctgtacccgtcttgcgggcccagact
cgggcccccacccagctgccacccctgctgcctgccccactggccccctgcccaccccct
atcaagaggaagccgggccggccccggcgatccccgccagctgtgctttccttggatggg
cccttggtccggccgccaggaggggccaccctgggcagggacctcctgcttctgccaggc
cagccacagacccctgtcttccctagcacccatgacccccggactgtgaccctggacttc
cggaacgcggggatcccagcccccccaccgcccctgccccccnagcctcctccaccccca
cctccaccacctgttgagcccaccaagctgccctttaaggagctagaaaaccagtggccc
tccgaggccatcctttcaggtccccgtgggcgggacgaggtcacccaggaattcatggat
ctgcacaaggtgcgggggccctggcgccggccacccaagaagcgtcacgaggacctggtg
gcctcagtctcacctgagctctcgccgccgcagcccctcttccggccccgcacagaattt
gaggagatgaccatcctgtatgacatctggaatggtggcattgatgaggaggacatccgc
ttcctgtgtgtcacctacgagcggctgctgcagcaggacaatggcatggactggctcaat
gacacgctctgggtctaccatccctccaccagcctctcttcagctaagaaaaagaagcgg
gacgacggcatccgggagcatgtgacaggctgtgcccgcagcgagggcttctacaccatc
gataagaaggacaagctcagatacctcaacagcagccgcgccagcaccgacgagcccccc
acggacacccagggcatgagtatccccgcgcagcctcacgcctccacgcgggccggctct
gagcgccgttcagagcaacgccgcctgttgtcctccttcactggcagctgtgacagcgac
ctgctcaagttcaaccagctcaagttccggaagaagaagctcaaattctgcaagagtcac
attcacgactggggtcttttcgccatggagcccattgcggccgacgagatggtcatcgag
tatgtaggccagaacatccgccaggtgatcgcagacatgcgggagaagcgttacgaggac
gagggcatcgggagcagctacatgttccgggtggaccacgacaccatcatcgacgccacc
aagtgtggcaacttcgcacgtttcatcaaccacagctgcaatcccaactgctacgccaag
gtcatcacggtggaatcgcagaagaagatcgtcatctactcgaagcagcacatcaacgtc
aacgaggagatcacctatgactacaagttccccatcgaggacgtcaagatcccctgcctc
tgcggctccgagaactgccgggggaccctcaactag

DBGET integrated database retrieval system