KEGG   Sus scrofa (pig): 100156226
Entry
100156226         CDS       T01009                                 

Gene name
EP300
Definition
(RefSeq) LOW QUALITY PROTEIN: histone acetyltransferase p300
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04024  cAMP signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04068  FoxO signaling pathway
ssc04110  Cell cycle
ssc04310  Wnt signaling pathway
ssc04330  Notch signaling pathway
ssc04350  TGF-beta signaling pathway
ssc04520  Adherens junction
ssc04630  JAK-STAT signaling pathway
ssc04720  Long-term potentiation
ssc04916  Melanogenesis
ssc04919  Thyroid hormone signaling pathway
ssc04922  Glucagon signaling pathway
ssc04935  Growth hormone synthesis, secretion and action
ssc05016  Huntington disease
ssc05152  Tuberculosis
ssc05161  Hepatitis B
ssc05164  Influenza A
ssc05165  Human papillomavirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05200  Pathways in cancer
ssc05203  Viral carcinogenesis
ssc05206  MicroRNAs in cancer
ssc05211  Renal cell carcinoma
ssc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100156226 (EP300)
   04330 Notch signaling pathway
    100156226 (EP300)
   04350 TGF-beta signaling pathway
    100156226 (EP300)
   04630 JAK-STAT signaling pathway
    100156226 (EP300)
   04066 HIF-1 signaling pathway
    100156226 (EP300)
   04068 FoxO signaling pathway
    100156226 (EP300)
   04024 cAMP signaling pathway
    100156226 (EP300)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100156226 (EP300)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100156226 (EP300)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100156226 (EP300)
   04935 Growth hormone synthesis, secretion and action
    100156226 (EP300)
   04919 Thyroid hormone signaling pathway
    100156226 (EP300)
   04916 Melanogenesis
    100156226 (EP300)
  09156 Nervous system
   04720 Long-term potentiation
    100156226 (EP300)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100156226 (EP300)
   05206 MicroRNAs in cancer
    100156226 (EP300)
   05203 Viral carcinogenesis
    100156226 (EP300)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100156226 (EP300)
   05215 Prostate cancer
    100156226 (EP300)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100156226 (EP300)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100156226 (EP300)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100156226 (EP300)
   05161 Hepatitis B
    100156226 (EP300)
   05164 Influenza A
    100156226 (EP300)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100156226 (EP300)
   05165 Human papillomavirus infection
    100156226 (EP300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    100156226 (EP300)
   03036 Chromosome and associated proteins [BR:ssc03036]
    100156226 (EP300)
   03029 Mitochondrial biogenesis [BR:ssc03029]
    100156226 (EP300)
Enzymes [BR:ssc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100156226 (EP300)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    100156226 (EP300)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100156226 (EP300)
Mitochondrial biogenesis [BR:ssc03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100156226 (EP300)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 100156226
NCBI-ProteinID: XP_001929248
Ensembl: ENSSSCG00000000068
UniProt: A0A480QJT4
LinkDB
Position
5
AA seq 2421 aa
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
ISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQSMASQAQQNSPGLGLINS
MVKSPMAQAGLTSPNMGMGTSGPNQGPTPSATGMMNSPVNQPAMGMNTGMNAGMNPGMLA
AGNGQGMMPNQVMNGSIGAGRGRPNMQYPNPGLANAGNLMTEPLQQGSPQMGGQTGLRGP
QPLKMGMMNNPNPYGSPYTQNSGQQMGASGLGLQIPTKSVLPNSLSPFAMDKKAVPGGGM
PNMGQQQAPPPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQA
NGEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPL
KNAGDKRNQQSILTGAPVGLGNTSSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQV
NQMPTPPQVQAKSQXNQQSGQSPQGMRPMSNMSASPMGVNGGVGVQTSNLLSDSMLHSAI
NSQNPMMSENASVASLGPMPTAAQPSSTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDP
AALKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNM
LPSAASMVPVSMNPGPNMGQPQPGMTSNGPLPDPSVIRGSVPNQMMPRITPQPGLNQFGQ
MSMPQPPIGPRQTSPLQHHGQLAQPGTLNPPMGYGPRMQQPSSQSQFLPQAQFPAQGMNV
TNMPLAPSGGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPPLPQPVLHQNSPSPVPS
RTPTPHHTPPSIGAQQPPATAIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPPTQLPPQV
QPSLPAAPTADQPQQQPLSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPST
SSTEVNSQNIPEKQPSQEVKMEAKMEVDPPEPADTQPEDIPETKAEDCKVEPTETEERGT
ELKAETKEEEDQPSTSATQSSPAPGQSKKKIFKPDELRQALMPTLEALYRQDPESLPFRQ
PVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSR
VYKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNR
YHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQI
CVLHHEIIWPSGFVCDGCLKKTARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPE
SGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMH
VQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWA
CPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTS
AKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSSESTDVTKGDSKNAKKKNNKKTS
KNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDP
LIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHV
ETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQR
CIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQ
ENKCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTT
PTGQQPATPQTPQPQPPSQPQPTPPNSMPPYLPRTQAPGPVSQGKAAGQVTPPTPPQTAQ
PPLPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPQMPPMAPMGMNPPPMARG
PSGHLEPGMGPAGMQQQPPWAQGGLPQPQQLQSGMPRPAMMSVSQHGQPLNMAPQPGLGQ
VGVSPLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANS
NPQPLPGQPGMPQGQPGLQPPTMPGQQGVHSGPAMQNMNPLQAGVQRAGLPPQQPQQQLQ
PPMGGVSPQAQQMNVNHSTMPSQFRDILRRQQMMQQQQQGAGPGIGPGMANHNQFQQPQG
VGYAPQPQPQPQQRMQHHMQQIQQGNMGQVGQLPQALGAEAGASLQAYQQRLLQQQMGSP
AQPNPMSPQQHMLPSQAQSPHLQGQQLPSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQP
QPSPHHVSPQTSSPHPGLVAAPGNPMEQGHFASPDQNTMLSQLASNPGMANLHGASATDL
GLSTENSDLNSNLSQSTLDIH
NT seq 7266 nt   +upstreamnt  +downstreamnt
atggccgagaatgtggtggaaccggggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcgtccgccagcgatggcacagattttggctctctatttgacttggag
catgacttaccagatgaattaatcaactctacagaattgggactaaccaatggtggtgat
attagtcagcttcagacaagtcttggcatagtacaagatgcagcctctaaacataaacaa
ctgtcagaattgctacggtctggtagttcccctaacctcaatatgggggttggtggccca
ggccaaagcatggccagccaggcccaacagaacagtcctggattaggtttgataaatagt
atggtcaaaagcccaatggcacaggcaggcttgacttctcccaacatggggatgggcact
agtggaccaaatcagggtcctacgccatctgcaacaggtatgatgaacagtccagtaaat
cagcctgccatgggaatgaacacagggatgaatgctggcatgaatcctggaatgttggct
gcaggcaatggacaggggatgatgcctaatcaagtcatgaacggttcaattggagcaggc
cgggggcgacctaatatgcagtacccaaacccaggcctggcaaatgctggcaacttaatg
actgagccactgcagcaaggctctccccagatgggaggacagacaggattgagaggccct
cagcctcttaagatgggaatgatgaacaaccctaatccttacggttcaccatacactcag
aattctggacagcagatgggagccagtggccttggtctccagataccgacaaagtctgta
ctaccaaatagcttatctccatttgcaatggataaaaaggcagttcctggtggaggaatg
cccaacatgggccagcagcaggccccacccccacaggtccagcagccaggtctggtgact
ccagtagcccaagggatgggttctggagcgcacacggctgatccagagaagcgcaagctt
atccagcagcagcttgttctcctcttgcatgctcacaagtgccagcgccgggagcaggct
aatggggaagtgaggcagtgcaaccttccccactgtcgtacaatgaagaacgtccttaac
cacatgacacactgccagtcaggcaagtcctgccaagtggcacactgtgcatcttctcga
caaatcatttcacactggaagaattgtacaaggcatgattgtcctgtgtgcctgcccctt
aaaaatgctggagataagagaaatcagcagtcaattctgactggcgcaccagttggactt
ggaaatactagctctctaggagtgggtcagcagtctactcccagcctaagcactgttagt
cagattgaccccagctccatagaaagagcctatgcagcccttggactaccctaccaagta
aaccagatgcccacaccaccccaggtgcaagcaaagagccagncaaaccagcagtctggg
cagtctccccaggggatgcggcccatgagcaacatgagtgctagtcctatgggagtaaat
ggaggtgtgggagttcaaacatcgaatcttctttctgactcgatgttgcattcagccata
aattctcaaaacccaatgatgagtgaaaatgccagcgtggcctccctgggtcctatgcca
acagcagctcaaccatctagtactggaattcggaaacaatggcatgaagatattactcag
gatcttcgaaatcatcttgttcacaaacttgttcaagccatatttcctactccggatcct
gctgctttaaaagacagacgaatggaaaaccttgttgcatatgcccggaaagtggaagga
gacatgtatgaatctgcaaacaatcgagcggaatactaccacctgctagctgagaagatc
tataagatccagaaggaactagaagaaaagcgaaggactagactgcaaaaacagaacatg
ctaccaagtgctgcaagcatggtgccagtttccatgaacccagggcctaatatgggacag
ccacaaccagggatgacttctaacggtcccttgcctgatccctctgtgatccgtggcagt
gtgccaaaccagatgatgcctcggataactccacagcccggtttgaatcagtttggccag
atgagtatgccccagccccctattggacctcggcaaacctctcctcttcagcaccatgga
cagttagctcaacctggaactctcaacccgcctatgggctatggacctcgcatgcagcag
ccttccagccagagccagtttcttcctcaggctcagttcccagcacagggaatgaatgta
acaaatatgcctttggcgccatctggcggtcaagcaccagtgtctcaagcacaaatgtcc
agttcttcctgccctgtgaactctcctataatgcctcctgggtctcaagggagccacatt
cactgtccgcctctccctcaaccagttttgcatcagaattcaccttctcctgtacctagt
cgtacccccacccctcaccacactcccccaagcataggggctcagcagccaccagcaaca
gcaattccagcccctgttcctacacctccagccatgccaccagggccacagtcccaggct
ctacatccacctccaagacagacgcctacaccaccaccaacgcaacttcctccccaagtg
cagccttcactccctgctgctcctacagctgaccagccgcaacagcagcctctgtcacag
caaagtacagctgcctctgttcccaccccaacagcgccactgcttcctccgcagccggca
actccactttcccagccagctgtaagcatcgaagggcaggtgtcaaaccctccttctact
agtagcacagaagtgaattctcagaacattcctgagaagcagccttcacaggaagtgaaa
atggaggctaaaatggaagtggatccaccagaaccagcagatactcagccagaggatatt
ccagagactaaagcagaagactgcaaagtggaacctacagaaacagaagagagaggcact
gaattaaaagctgaaacaaaagaggaagaagaccagccaagtacttcagctacccagtcg
tctccagccccaggacagtcaaagaagaagattttcaaacctgacgagttacgacaggca
ctgatgccgacattggaggcactttaccgtcaggatccagagtcccttccctttcgtcag
cctgtggatcctcaacttctaggaatccctgattactttgacattgtgaagagccccatg
gatctttctaccatcaagaggaagttagacactggacagtatcaggaaccctggcagtat
gtggacgacatttggctcatgtttaacaatgcttggttatataatcggaaaacgtcacgg
gtgtacaaatactgctccaagctatcagaggtctttgaacaagaaattgacccagtcatg
cagagtcttggatactgttgtggtagaaagttggaattctctccacagacactctgttgc
tatggcaaacagttatgcacaatcccccgtgatgccacttattacagttaccaaaacagg
tatcatttctgtgagaagtgtttcaatgaaatccaaggggagagcgtttctttgggggat
gacccttcccagcctcaaactacaataaacaaggaacaattttcaaagagaaaaaatgac
actctggatcctgaactgtttgttgaatgtacagagtgtggaagaaagatgcatcagatc
tgtgtccttcatcatgagatcatctggccatctggatttgtctgtgatggctgtttgaag
aaaactgcacggactagaaaagaaaataagttttctgctaaaaggttgccatctaccagg
cttggcacctttctggagaatcgtgtgaatgattttctgaggcgacaaaatcaccctgag
tcgggagaggtcactgttcgagtagttcatgcttctgacaaaactgtggaagtcaaacca
ggaatgaaagcaaggtttgtagacagtggagagatggcagaatcttttccgtatcgaacc
aaagccctctttgccttcgaagagatcgatggggttgacctgtgcttcttcggcatgcac
gttcaggagtacggctctgactgccctccacccaaccagaggagagtgtacatatcatac
ctcgacagcgttcatttcttccgtcctaaatgcttgaggactgcagtgtatcatgaaatt
ctaattggatatttggagtacgtcaagaaactaggatatacaacagggcatatttgggca
tgtcccccaagtgagggagatgactatatattccattgccatccccccgaccagaagata
cccaagcctaagcgactgcaggagtggtacaaaaagatgctcgacaaggccgtgtccgag
cgaattgtccacgactacaaggatatttttaaacaagctactgaagatcgattaacaagt
gcgaaggaattgccttactttgagggtgatttctggcccaatgttctggaagagagcatt
aaggaactggaacaggaggaggaagagagaaagcgcgaggagaacaccagcagtgaaagc
acagacgtgacaaagggagacagcaaaaatgctaaaaagaagaataataagaaaaccagc
aaaaacaagagcagcctgagtaggggcaataagaagaagccaggcatgcccaatgtgtct
aatgatctctcgcaaaaactctatgccaccatggagaagcacaaagaggtcttctttgtg
atccgtctcatcgctggccctgccgccaactccctgccgcccatcgtggatcccgacccc
ctcatcccctgcgacctgatggatgggcgggatgcctttctcaccctcgcaagggacaaa
cacctggagttctcctccctccgaagagcccagtggtccaccatgtgcatgctggtggag
ctgcacacccagagccaggaccgctttgtctacacctgcaacgagtgcaagcaccacgtg
gagacacgctggcactgcactgtgtgcgaggattatgatttgtgtatcacctgctataac
actaaaaaccacgaccacaaaatggagaaactgggtcttgggttagatgatgagagcaac
aaccagcaggccgcggccacccagagcccaggagactcccgccgcctgagcatccagcgc
tgcatccagtctctggtccacgcctgccagtgccgcaacgccaactgctcactgccctcc
tgccagaagatgaagcgggtcgtgcagcacaccaagggctgcaagcggaaaaccaacgga
gggtgccccatctgcaagcagctcatcgccctctgctgctaccatgccaagcactgccag
gagaacaagtgccctgtgcccttctgcctcaacatcaagcaaaagctccggcagcagcag
ctgcagcaccggctccagcaggcccagatgcttcgcaggaggatggccagcatgcagcgg
acgggcgtggtggggcagcagcagggcctgccctccccaactcctgccactccaaccaca
ccaacgggccaacagccagccaccccccagacgccccagccccagcccccctctcagccc
cagcccaccccgcccaacagcatgccgccctatttgcccaggactcaagcccctggccct
gtgtcccagggcaaggcagcaggccaggtgacgcctccaacccctccgcagactgctcag
ccaccccttccaggacccccacctgcagcggtggagatggcaatgcagattcagagggca
gcggagacacagcgccagatggcccacgtgcagatttttcaacggccgatccagcaccag
atgccccagatgcctccaatggcccccatgggtatgaacccgccccccatggccagaggt
cccagcgggcatttggagccagggatggggcctgcagggatgcagcaacaaccaccctgg
gcccaaggagggttgcctcaaccccagcaactccagtctgggatgccgaggccggccatg
atgtcagtgtcacagcacggtcagcccttgaacatggctccccagccaggactgggccag
gtaggtgtgagccctctcaaaccaggcactgtatctcaacaagccttacaaaaccttctg
cggactctcaggtctcccagctctcccctgcagcagcagcaggtgctcagtatcctccat
gccaacccccagctgttggctgcgttcatcaagcagcgggctgccaagtatgccaactcc
aacccgcagcccctccctgggcagcctggcatgccccagggccagccggggctgcagcca
cctaccatgcccggtcagcagggagtccactccggccccgccatgcagaacatgaacccc
ctgcaagcaggcgtccagagggctggcctgcccccgcagcagccacagcagcagctccag
ccgcccatgggaggggtgagcccccaggctcagcagatgaacgtgaaccacagcaccatg
ccttcacagttccgcgacatactgagacgacagcagatgatgcagcagcagcagcaggga
gcagggccaggaattggccccggaatggccaaccataaccagttccagcaaccccaaggg
gttggctatgccccgcagccgcagcctcagccgcagcagcggatgcagcatcacatgcag
cagatacagcaggggaacatgggacaggtgggccagctcccccaggccctgggagcagag
gcaggagccagtctgcaggcctatcagcagcgactccttcagcaacagatggggtcgcct
gctcagcccaaccccatgagcccccaacagcacatgctcccgagccaggctcagtcccca
cacctgcaaggccagcagctcccttctctctccaatcaagtgcgttctccccagcctgtc
ccctctccacggccgcagtcccagcccccccactccagcccttccccaaggatgcagcct
cagccttcgccacaccatgtctccccacagaccagttctccacatcctggactggtagcc
gccccgggcaaccccatggaacaagggcattttgccagcccagaccagaatacaatgctt
tctcagctcgctagcaatccgggcatggcaaacctccatggtgcaagcgccacggacctg
ggactcagcaccgagaactcggacttgaattcaaacctctcacagagtacactagacata
cactag

KEGG   Sus scrofa (pig): 100620215
Entry
100620215         CDS       T01009                                 

Gene name
CREBBP
Definition
(RefSeq) CREB-binding protein
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04024  cAMP signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04068  FoxO signaling pathway
ssc04110  Cell cycle
ssc04310  Wnt signaling pathway
ssc04330  Notch signaling pathway
ssc04350  TGF-beta signaling pathway
ssc04520  Adherens junction
ssc04630  JAK-STAT signaling pathway
ssc04720  Long-term potentiation
ssc04916  Melanogenesis
ssc04919  Thyroid hormone signaling pathway
ssc04922  Glucagon signaling pathway
ssc04935  Growth hormone synthesis, secretion and action
ssc05016  Huntington disease
ssc05152  Tuberculosis
ssc05161  Hepatitis B
ssc05164  Influenza A
ssc05165  Human papillomavirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05200  Pathways in cancer
ssc05203  Viral carcinogenesis
ssc05206  MicroRNAs in cancer
ssc05211  Renal cell carcinoma
ssc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100620215 (CREBBP)
   04330 Notch signaling pathway
    100620215 (CREBBP)
   04350 TGF-beta signaling pathway
    100620215 (CREBBP)
   04630 JAK-STAT signaling pathway
    100620215 (CREBBP)
   04066 HIF-1 signaling pathway
    100620215 (CREBBP)
   04068 FoxO signaling pathway
    100620215 (CREBBP)
   04024 cAMP signaling pathway
    100620215 (CREBBP)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100620215 (CREBBP)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100620215 (CREBBP)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100620215 (CREBBP)
   04935 Growth hormone synthesis, secretion and action
    100620215 (CREBBP)
   04919 Thyroid hormone signaling pathway
    100620215 (CREBBP)
   04916 Melanogenesis
    100620215 (CREBBP)
  09156 Nervous system
   04720 Long-term potentiation
    100620215 (CREBBP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100620215 (CREBBP)
   05206 MicroRNAs in cancer
    100620215 (CREBBP)
   05203 Viral carcinogenesis
    100620215 (CREBBP)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100620215 (CREBBP)
   05215 Prostate cancer
    100620215 (CREBBP)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100620215 (CREBBP)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100620215 (CREBBP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100620215 (CREBBP)
   05161 Hepatitis B
    100620215 (CREBBP)
   05164 Influenza A
    100620215 (CREBBP)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100620215 (CREBBP)
   05165 Human papillomavirus infection
    100620215 (CREBBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    100620215 (CREBBP)
   03036 Chromosome and associated proteins [BR:ssc03036]
    100620215 (CREBBP)
   03029 Mitochondrial biogenesis [BR:ssc03029]
    100620215 (CREBBP)
Enzymes [BR:ssc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100620215 (CREBBP)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    100620215 (CREBBP)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100620215 (CREBBP)
Mitochondrial biogenesis [BR:ssc03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100620215 (CREBBP)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 100620215
NCBI-ProteinID: XP_005662241
Ensembl: ENSSSCG00000007951
Vega: OTTSUSG00000003238
LinkDB
Position
3
AA seq 2440 aa
MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGGELGLLNSGNLV
PDAASKHKQLSELLRGGSSSSINPGIGNVSASSPVQQGLGGQAQGQPNSANMASLGAMGK
SPLNQGDSSAPNLPKQAASTSGPTPPASQALNPQAQKQVGLVTSSPATSQTGPGICMNAN
FNQTHPGLLNSNSGHSLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPAPAMQGATSSVLA
ETLTQVSPQMASHAGLNTAQTGGMTKMGMAGNTSPFGQPFSQAGGQQMGAPGVNPQIPGK
QSMVNSLPPFPADIKNASVTSVPNMSQMQTSVGIVPTQAIATGPTADPEKRKLIQQQLVL
LLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWK
NCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNATSLSNPNPIDPSS
MQRAYAALGLPYLNQPQTQLQPQVPGQQPAQPQTHQQMRTLNPLGNNPMNIPAGGITTDQ
QPPSLISESALPTSLGATNPLMSDGATSGNIGPLSTLPSAAPPSSTGVRKGWHEHVTQDL
RSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYK
IQKELEEKRRSRLHKQGILGNQPALPAPGTQPPGIPQAQPVRPPNGPMPLPVNRMQVSQG
MNSFTPMSLGNVQLPQAPMGPRAASPMNHSVPMNSMGSVPGMAISPSRMPQPPNMMGTHA
NNMMAQAPAQNQFLPQNQFPSASGAMSVNSVGLGQPAAQAAVSQGQVPGAALPNPLNMLG
PQASQLPCPPVTQSPLHQTPPPASTAAGLPSLQHPVAPGMTPPQPAAPTQPSTPVSSSGQ
TPTPTPGSVPSASQSQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHTQPP
GTPLSQAAASIDNRVPTPSSVASAETNSQQPGPDVPVLEMKAEVKTEDTEPDASEPKGEP
GSGMMEEDLQGSSQVKEETDTTEQKSEPMEVDEKKPEVKVEAKEEEDGGANGAASQSTSP
SQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLST
IKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
YCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQ
PQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGR
TRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKS
RFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSI
HFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPK
RLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELE
QEEEERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDL
SQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWE
FSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKS
HTHKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQK
MKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQH
RLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVSMS
PAGFPSVARTQPPTTVSAGKPTSQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRVNI
NNGMPPGRTGMVTPGSQMAPVGLNVPRPNQVSGPVVPNLPPGQWQQAPIPQQQPMPGMPR
PVMSMPAQPAVAGPRMPSVQPPRSISPGALQDLLRTLKSPSSPQQQQQVLNILKSNPQLM
AAFIKQRTAKYVASQPGLQAQPSLQAQPGLQPQPGLHQQPGLQNLNAMQAGGPRPGVPPQ
QQTMGGLNPQGQALNIMNPGHSPSMASMNPQYREMLRRQLLQQQQQQQQQQQQQQGGAGM
AGGMAGHGQFQQPQGPGGYPPAMQQQRMQQHLPIQGGSMGQMAAQMGQLGQMGQPGLGAD
STPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQMATSLSSQ
VRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSIDQGHLGN
PEQSAMLPQLNTPNRSALSSELSLVGDTTGDTLEKFVEGL
NT seq 7323 nt   +upstreamnt  +downstreamnt
atggccgagaacttgctggacggaccgcccaaccccaaacgagccaaactcagctcgccc
ggcttctctgcgaatgacagcacagattttggatcattgtttgacttggaaaatgatctt
cctgatgagctgatccccaatggaggagaattaggccttttaaacagtgggaaccttgtt
ccagatgctgcttccaaacataaacaactgtcagagcttctgcgaggaggcagcagctct
agtatcaacccaggaataggaaatgtgagcgccagcagccccgtgcagcaaggcctcgga
ggccaggcccaggggcagccgaacagtgcgaacatggccagtctgggtgccatgggcaag
agccctctgaaccagggagattcttctgcccctaacctgcccaaacaggcagccagcacc
tctgggcccactccccctgcttcccaagcactgaatccgcaagcacaaaagcaagtgggg
ctggtgaccagcagccctgccacgtcgcagacgggacctgggatctgcatgaatgctaac
ttcaaccagacccacccaggcctccttaatagtaactctggccatagtttaatgaaccag
gcccagcaggggcaggcgcaagtcatgaatgggtctcttggggctgctggcagaggaaga
ggagctggaatgccataccctgctccggccatgcagggggccaccagcagcgtgctggct
gagacgttaacacaagtgtcaccacaaatggccagtcacgcaggactgaacacagcgcag
accggaggcatgaccaagatgggaatggctggtaacacaagtccatttggacagcccttt
agtcaagctggagggcagcagatgggagcccccggcgtgaacccccagatacccggcaag
cagagcatggtcaacagcctgcctcccttccctgcagacatcaagaatgcttcggtcacc
agtgtgccaaacatgtctcagatgcaaacgtcggtgggaattgtgcccacgcaggcgatt
gccacgggcccgacagcagacccagagaagcgcaaactgattcagcagcagctggtcctc
ctgcttcacgctcacaagtgtcagaggcgggaacaagccaatggagaggttcgagcctgc
tccctcccacactgtcgaaccatgaaaaatgtcctgaatcacatgacacattgtcaggct
gggaaagcctgtcaggttgcccattgtgcatcttcacgacaaatcatctctcattggaag
aactgcacgcgacatgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcga
aaccaacaaaccatcctggggtctccagctagtggaattcaaaacacaattggttctgtt
ggcacaggccagcagaatgccacttcattaagtaacccaaatcccatagaccccagctcc
atgcagcgtgcctatgcggctcttggactcccctacctgaaccagccccagacgcagctg
cagcctcaggttcccggccagcaaccagcacagcctcaaactcaccagcagatgaggact
ctcaaccccctgggaaataacccaatgaacattccagcaggcggaataacaacagatcag
cagccaccaagcttgatttcagaatcagctcttccaacttcccttggggccaccaacccc
ctgatgagcgacggcgccacctctgggaacatcggacccctcagcactctaccctccgca
gcacctccttccagcactggcgttcggaaaggctggcacgaacacgtcactcaggacctg
cgcagccatctagtacacaaactcgtccaagccatcttcccgacccctgaccccgcagcc
ctgaaggatcgccgcatggagaacctggtggcctatgcgaagaaggtggaaggggacatg
tacgagtctgccaacagcagggatgagtactatcacttattagcagagaaaatctacaag
atacaaaaggaactagaagaaaaacggaggtcacgtttacacaaacaaggcatcttgggg
aaccagcccgccttaccagcccctgggacgcagccccctggcataccacaggcccagccc
gtgagaccgccaaatgggcccatgcccctgcctgtgaaccgcatgcaggtttctcaaggg
atgaattcatttaccccaatgtccttggggaacgtacagttgccacaagctcccatggga
ccgcgcgcagcatcccccatgaaccactctgtcccaatgaacagcatgggctctgttcca
gggatggccatttctccttcccgaatgcctcagcctccaaacatgatgggcacacatgcc
aacaacatgatggcccaggcgcctgcgcagaaccagttcctgccgcagaatcagttcccg
tcagccagcggggccatgagtgtgaacagcgtgggcttggggcagccggcggcacaggca
gccgtgtcccaggggcaggtgcctggggctgctctccccaaccctctgaacatgcttggg
ccccaggccagccagctgccttgcccaccagtgacacagtcaccgctgcaccagactccg
cctcctgcttccacggccgcaggcttgccatctctccagcatcccgtggcccctgggatg
acgcccccccagccggcagcgcccacccagccgtcaactccagtgtcgtcttccgggcag
actcccaccccaactcccggctcagtgcccagtgctagccaaagccagagcacccctact
gtccaggcggcggcccaggcccaggtgaccccgcagcctcagaccccagtccagcctccg
tctgtggccaccccccagtcgtcacagcagcagccgacgcctgtgcacacccagcctcct
ggcacaccgctttcccaggcagcagccagcattgacaacagggtccccaccccctcctcc
gtggccagcgcagaaaccaactcccagcagccagggcccgacgtgccagtgctagagatg
aaggctgaggtcaagactgaagacaccgagcccgatgccagtgaacccaagggagagcct
ggctctgggatgatggaggaggatttacaaggatcctctcaagttaaagaagaaaccgac
acaacagagcagaaatcggaaccaatggaagtagatgaaaagaaacccgaagtgaaagtc
gaagctaaagaggaagaagacggtggcgccaacggggcggcctctcagtccacttctcct
tcgcagcctcgcaaaaaaatctttaagccggaggagttacgccaggctctcatgccaacc
ctagaagcgctgtatcggcaggatcccgagtccttaccttttcggcagcctgtagatccc
cagctcctgggaattccagattattttgacattgtgaagaatcccatggacctttctacc
atcaagcggaagctggacacggggcagtaccaagagccctggcaatacgtggacgatgtc
tggctcatgttcaacaacgcctggctctacaatcggaagacgtcccgggtgtacaagttc
tgcagtaaactcgcagaggtctttgagcaggaaatcgaccccgtcatgcagtcccttggg
tattgctgtggacgaaagtacgagttttccccacagactttgtgctgctacgggaagcag
ctgtgcacaattcctcgtgatgctgcctactacagctatcagaataggtatcatttctgt
gagaagtgtttcacagagatccagggggagaatgttaccctgggtgacgacccttcacag
ccccagacgacaatttcaaaggatcaatttgaaaagaagaaaaatgataccttagatcct
gaacctttcgttgattgcaaggagtgtggccggaagatgcatcagatttgtgtgctccac
tatgatatcatttggccttcgggctttgtgtgcgacaactgcttgaagaaaacgggcaga
actcggaaagaaaacaaattcagtgctaagagactgcagaccacacgattggggaaccac
ttggaggaccgagtcaacaagtttctgcggcgacagaatcatcccgaagccggggaggtc
tttgtccgagtggtggccagttcagacaagacggtggaggtcaagccggggatgaagtca
cggtttgtggattctggggaaatgtctgagtctttcccataccgaaccaaagcgctcttt
gccttcgaggagattgacggagtggacgtgtgcttctttgggatgcacgtccaggagtat
ggctctgactgcccgccgcccaacacaaggcgtgtgtacatatcttatctggatagtatt
catttcttccgaccccgatgcctccgaacggctgtttaccacgagatccttattggatat
ttagaatatgtgaagaaattggggtatgtaacaggacacatctgggcctgtcccccaagt
gaaggagatgactacatcttccactgccacccccctgatcagaaaatcccgaagccgaag
cgcctgcaggagtggtacaagaagatgctggacaaggccttcgccgagcggatcatccac
gactacaaggacattttcaaacaagcaactgaagacaggctcaccagtgccaaggagctg
ccctattttgagggcgacttctggcctaacgtgttggaggagagcattaaggagctggag
caggaagaggaggagcggaagaaggaggagagcacggcggccagcgagaccacagagggc
agtcagggcgacagcaagaacgccaagaagaagaacaataagaaaaccaacaagaacaaa
agcagcatcagccgagccaacaagaagaagcccagcatgcccaacgtgtccaacgacctg
tcccagaagctctacgccaccatggagaagcacaaagaggtcttctttgtgatccacctc
catgccgggcccgtcatcaacacgctgccccccatcgtggaccccgaccccctgctcagc
tgcgacctcatggatgggcgggacgccttcctcacgctggccagggacaagcactgggag
ttttcctccctgcggcgctccaagtggtccacgctgtgcatgctggtggagctgcacacc
cagggccaggaccgctttgtctacacctgcaacgagtgcaagcaccacgtggagacgcgc
tggcactgcaccgtgtgcgaggactacgatctctgcatcaactgctacaacacgaagagc
cacacccacaagatggtgaagtgggggctgggcctggacgacgagggcagcagccagggc
gagccgcagtccaagagcccccaggagtcgcggcgcctgagcatccagcgctgcatccag
tccctggtgcacgcctgccagtgccgcaacgccaactgctcgctgccgtcctgccagaag
atgaagcgggtggtgcagcacaccaagggctgcaagcgcaagaccaatggcggctgcccg
gtgtgcaagcagctcattgccctctgctgctaccacgccaaacactgccaagaaaacaag
tgccccgtgcccttctgcctcaacatcaaacacaagctccgccagcagcagatccagcac
cgcctgcagcaggcccagctcatgcgccggcggatggccaccatgaacacccgcaacgtg
cctcagcagagcctgccatcccctacctcagcgccgcccgggacccccacgcagcagccc
agcacgccccagacgccgcagccccctgcccagccccagccctcgcctgtgagcatgtca
ccagccggcttccccagcgtggcccggactcagccccccacgacggtgtccgccgggaag
cccaccagccaggtgccggccccgccgccccctgcccagcccccgcccgcggcggtggag
gcggcccggcagatcgagcgcgaggcccagcagcagcagcacctgtaccgggtgaatatc
aacaacggcatgcccccggggcgcacgggcatggtgaccccgggcagccagatggccccc
gtgggcctgaacgttccccggcccaaccaggtcagcgggcctgttgtgcccaacctgccg
cctgggcaatggcagcaggcgcccattccccagcagcagccaatgccaggcatgcccagg
cccgtgatgtccatgccggcccagccggccgtggcggggccgcggatgcccagcgtgcag
ccgccccggagcatctcgcctggcgccctgcaggacttgctgcggaccctgaaatccccc
agctccccgcagcagcagcagcaggtgctcaacatcctcaagtccaaccctcagctgatg
gcagctttcatcaaacagcgcacggccaagtacgtggccagtcagcccggcctccaggcc
cagcccagcctccaggcgcagcctggtctgcagccccagcccggcctgcaccagcagccc
ggcctgcagaacctgaacgccatgcaagctggcgggccgaggcctggggtgcctccgcag
cagcagacgatgggcggcctgaacccccagggccaggccctgaacatcatgaacccgggg
cacagccccagcatggcgagtatgaacccacagtaccgagagatgctgcgaaggcagctc
ctgcagcagcagcagcagcagcagcagcagcagcagcagcagcagggcggcgctggcatg
gccgggggcatggcagggcacggccagttccagcagcctcaaggaccgggaggctacccc
ccagccatgcagcagcagcggatgcagcagcacctccccatccagggcggctccatgggc
cagatggcggcccagatgggacagctcggccagatggggcagcctgggctgggcgcagac
agcacccccaacatccagcaggccctgcagcagcggatcctgcagcagcagcagatgaag
cagcagatcgggtccccaggccagccgaaccccatgagcccccagcagcacatgctctca
ggacagccccaggcctcgcacctccccggccagcagatggccacgtccctcagtagccag
gtgcggtctccggcccctgtccagtctccgcggccccagtcccagcctccacattccagc
ccgtcgccacggatacagccccagccttcaccacatcacgtgtcgccccagactggttcc
ccccaccccggactggcagtcaccatggccagctccatagatcagggacacttggggaac
cccgaacagagtgcaatgctcccccagctgaacacccccaacaggagtgcgttgtccagt
gagctgtccctggtcggcgacaccacgggagacaccctagaaaagtttgtggagggtttg
tag

DBGET integrated database retrieval system