KEGG   Sus scrofa (pig): 100156264
Entry
100156264         CDS       T01009                                 

Gene name
PTEN
Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00562  Inositol phosphate metabolism
ssc01100  Metabolic pathways
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc04068  FoxO signaling pathway
ssc04070  Phosphatidylinositol signaling system
ssc04071  Sphingolipid signaling pathway
ssc04115  p53 signaling pathway
ssc04140  Autophagy - animal
ssc04150  mTOR signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04218  Cellular senescence
ssc04510  Focal adhesion
ssc04931  Insulin resistance
ssc05165  Human papillomavirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05200  Pathways in cancer
ssc05206  MicroRNAs in cancer
ssc05213  Endometrial cancer
ssc05214  Glioma
ssc05215  Prostate cancer
ssc05218  Melanoma
ssc05222  Small cell lung cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05230  Central carbon metabolism in cancer
ssc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ssc05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100156264 (PTEN)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100156264 (PTEN)
   04070 Phosphatidylinositol signaling system
    100156264 (PTEN)
   04071 Sphingolipid signaling pathway
    100156264 (PTEN)
   04151 PI3K-Akt signaling pathway
    100156264 (PTEN)
   04150 mTOR signaling pathway
    100156264 (PTEN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100156264 (PTEN)
  09143 Cell growth and death
   04115 p53 signaling pathway
    100156264 (PTEN)
   04218 Cellular senescence
    100156264 (PTEN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100156264 (PTEN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100156264 (PTEN)
   05206 MicroRNAs in cancer
    100156264 (PTEN)
   05230 Central carbon metabolism in cancer
    100156264 (PTEN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100156264 (PTEN)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100156264 (PTEN)
   05214 Glioma
    100156264 (PTEN)
   05218 Melanoma
    100156264 (PTEN)
   05215 Prostate cancer
    100156264 (PTEN)
   05213 Endometrial cancer
    100156264 (PTEN)
   05224 Breast cancer
    100156264 (PTEN)
   05222 Small cell lung cancer
    100156264 (PTEN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100156264 (PTEN)
   05165 Human papillomavirus infection
    100156264 (PTEN)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100156264 (PTEN)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100156264 (PTEN)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100156264 (PTEN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ssc01009]
    100156264 (PTEN)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100156264 (PTEN)
    3.1.3.48  protein-tyrosine-phosphatase
     100156264 (PTEN)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     100156264 (PTEN)
Protein phosphatases and associated proteins [BR:ssc01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    100156264 (PTEN)
SSDB
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase PTPlike_phytase Y_phosphatase3 DUF3256
Other DBs
NCBI-GeneID: 100156264
NCBI-ProteinID: NP_001137168
Ensembl: ENSSSCG00000010440
UniProt: B8XSI6
LinkDB
Position
14
AA seq 403 aa
MTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVA
AIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSY
LLKNHLDYRPVALLFHKMMFETIPMFSGGTCNPQFVVCQLKVKIYSSNSGPTRREDKFMY
FEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGGLCDQEI
DSICSIERADNDKEYLVLTLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPSNPEAS
SSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHTQITKV
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgacagccatcatcaaagagatcgttagcagaaacaaaaggagatatcaagaggatgga
ttcgacttagacttgacctatatttatccaaacattattgctatggggtttcctgcagaa
agacttgaaggcgtatacaggaacaatattgatgatgtagtaaggtttttggattcaaag
cataaaaaccattacaagatatacaatctatgtgctgaaagacattatgataccgccaaa
tttaactgcagagttgcacagtatcctttcgaagaccataatccaccacagctagaactt
atcaaacctttttgtgaagatcttgaccaatggctaagtgaagatgacaatcatgttgca
gcaattcactgtaaagctggaaagggacgaactggtgtaatgatttgtgcatatttgtta
catcggggtaaatttttaaaggcacaagaggccctagatttctatggggaagtaaggacc
agagacaaaaagggagtaactattcccagtcagaggcgctatgtgtattattatagctac
ctgttaaagaatcatctggattatagaccagtggcactgttgtttcacaagatgatgttt
gaaactattccaatgttcagtggcggaacttgcaatcctcagtttgtggtctgccagcta
aaggtgaagatatattcctccaattcaggacccacacgacgggaagacaagttcatgtac
tttgagttccctcagccattgcctgtgtgtggtgacatcaaagtagagttcttccacaaa
cagaacaagatgctaaaaaaggacaaaatgtttcacttttgggtaaatacattcttcata
ccaggaccagaggaaacctcagaaaaagtagaaaatggaggtctgtgtgatcaagaaatt
gatagtatttgcagtatagaacgtgcagataatgacaaggaatatctagtactcacttta
acaaaaaatgatctcgacaaagcaaataaagacaaggccaaccgatacttttctccaaat
tttaaggtgaagctgtacttcacaaaaacagtagaggagccatcaaatccagaggctagc
agttcaacttctgtaacaccagatgttagtgacaatgaacctgatcattatagatattct
gacaccactgactctgatccagaaaatgaaccttttgatgaagatcagcatacacaaatt
acaaaagtttga

DBGET integrated database retrieval system