KEGG   Sus scrofa (pig): 100156801
Entry
100156801         CDS       T01009                                 

Gene name
RXRB
Definition
(RefSeq) retinoic acid receptor RXR-beta
  KO
K08525  retinoid X receptor beta
Organism
ssc  Sus scrofa (pig)
Pathway
ssc03320  PPAR signaling pathway
ssc04659  Th17 cell differentiation
ssc04919  Thyroid hormone signaling pathway
ssc04920  Adipocytokine signaling pathway
ssc04928  Parathyroid hormone synthesis, secretion and action
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05216  Thyroid cancer
ssc05222  Small cell lung cancer
ssc05223  Non-small cell lung cancer
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100156801 (RXRB)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100156801 (RXRB)
   03320 PPAR signaling pathway
    100156801 (RXRB)
   04919 Thyroid hormone signaling pathway
    100156801 (RXRB)
   04928 Parathyroid hormone synthesis, secretion and action
    100156801 (RXRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100156801 (RXRB)
   05202 Transcriptional misregulation in cancer
    100156801 (RXRB)
  09162 Cancer: specific types
   05226 Gastric cancer
    100156801 (RXRB)
   05216 Thyroid cancer
    100156801 (RXRB)
   05222 Small cell lung cancer
    100156801 (RXRB)
   05223 Non-small cell lung cancer
    100156801 (RXRB)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    100156801 (RXRB)
Nuclear receptors [BR:ssc03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   100156801 (RXRB)
SSDB
Motif
Pfam: Hormone_recep zf-C4 Nuc_recep-AF1
Other DBs
NCBI-GeneID: 100156801
NCBI-ProteinID: NP_001177175
Ensembl: ENSSSCG00000001474
Vega: OTTSUSG00000001392
UniProt: A5D9P3 A0A4X1UQM7 Q0GFF5
LinkDB
Position
7
AA seq 532 aa
MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAAAGEQQTP
EPEPGQAGRDGMGDSGRDSRSPDSSSPNPLPQGAAPPSPPGPPLPPSAAASLGGSGAPPP
PPMPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVKP
PVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSC
RDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGAGGAPEEMPV
DRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFS
SLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRVL
TELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKYPE
QQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgtcttgggcggctcgcccgcccttcctcccccagcggcatgccgcagggcagtgtggg
ccggtgggggtgcgaaaagaaatgcattgtggggtcgcgtcccggtggcggcggcgacgg
ccctggctggatcccgcagcggcggcggcggcagcggcagccggagaacaacaaaccccg
gagccggagccggggcaggctggacgggacgggatgggcgacagcgggcgggactcccga
agcccagacagttcctccccaaatccccttccccagggggccgctcccccttctcctcct
gggccacccctaccaccttcagcagctgcatcccttggaggctctggggccccaccccca
cccccgatgccaccccccccactgggctccccctttccagtcatcagctcttccatgggg
tcccctggtctgccccctccagctcccccaggattctccgggcctgtcagcagtccccag
attaactcaacagtgtcgctccctgggggtgggtctggcccccctgaagatgtgaagcca
ccagtcttaggggtccggggcctgcactgtccaccccctccaggtggccctggggctggc
aaacggctatgtgcaatctgcggggaccgaagctcaggcaaacactacggggtttacagc
tgtgagggctgcaaaggcttcttcaagcgcaccatccgtaaggacctgacctactcgtgc
cgggacaacaaggactgcacggtggacaagcgccagcggaaccgctgtcagtactgccgc
tatcagaagtgcctggccacaggcatgaagcgggaggcggtacaggaggagcgccagcga
gggaaggacaaggacggggatggggagggggctgggggagcccctgaggagatgcccgtg
gacaggatcctggaggcagagcttgccgtggagcagaagagtgaccagggcgttgagggt
cctgggggaaccgggggtagcggcagcagcccgaatgaccctgtgactaacatctgtcag
gcagctgacaaacagctcttcacacttgttgagtgggcgaagaggatcccacacttctcc
tccttgcctctggatgaccaggtcatactgctacgggcaggctggaacgagctcctcatt
gcctccttctctcaccggtccattgacgtccgggatggcatcctcctcgccacaggtctt
cacgtgcaccgcaactcagcccattcggcaggcgtgggagccatctttgaccgggtgctg
acagagctagtgtccaaaatgcgtgacatgaggatggacaagacagaacttggctgcctg
agggcaatcattctgttcaatccagatgccaagggcctctccaaccccagtgaggttgag
gtcctgcgggagaaagtctacgcgtcactggagacctattgcaaacagaagtaccctgag
cagcagggacggttcgccaagctgctgctgcgtcttcctgctctcaggtccataggcctt
aagtgtctagagcatctgtttttcttcaagctcattggcgacacccccatcgacaccttc
ctcatggagatgcttgaggctccccaccagctggcctga

KEGG   Sus scrofa (pig): 397306
Entry
397306            CDS       T01009                                 

Gene name
RXRA
Definition
(RefSeq) retinoic acid receptor RXR-alpha isoform X1
  KO
K08524  retinoid X receptor alpha
Organism
ssc  Sus scrofa (pig)
Pathway
ssc03320  PPAR signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04659  Th17 cell differentiation
ssc04919  Thyroid hormone signaling pathway
ssc04920  Adipocytokine signaling pathway
ssc04928  Parathyroid hormone synthesis, secretion and action
ssc04932  Non-alcoholic fatty liver disease
ssc04976  Bile secretion
ssc05160  Hepatitis C
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05216  Thyroid cancer
ssc05222  Small cell lung cancer
ssc05223  Non-small cell lung cancer
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    397306 (RXRA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    397306 (RXRA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    397306 (RXRA)
   03320 PPAR signaling pathway
    397306 (RXRA)
   04919 Thyroid hormone signaling pathway
    397306 (RXRA)
   04928 Parathyroid hormone synthesis, secretion and action
    397306 (RXRA)
  09154 Digestive system
   04976 Bile secretion
    397306 (RXRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    397306 (RXRA)
   05202 Transcriptional misregulation in cancer
    397306 (RXRA)
  09162 Cancer: specific types
   05226 Gastric cancer
    397306 (RXRA)
   05216 Thyroid cancer
    397306 (RXRA)
   05222 Small cell lung cancer
    397306 (RXRA)
   05223 Non-small cell lung cancer
    397306 (RXRA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    397306 (RXRA)
  09172 Infectious disease: viral
   05160 Hepatitis C
    397306 (RXRA)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    397306 (RXRA)
Nuclear receptors [BR:ssc03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   397306 (RXRA)
SSDB
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Other DBs
NCBI-GeneID: 397306
NCBI-ProteinID: XP_020927105
LinkDB
Position
1
AA seq 439 aa
MAAPSLHPSLGPGIGSSLGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSLSVPTTP
TLGFGTGSPQLSSPMNPVSSSEDIKPPLGINGVLKVPAHPSGNMASFTKHICAICGDRSS
GKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKRE
AVQEERQRGKDRGENEVESTSSANEDMPVEKILEAELAVEPKTETYVEANVGLNPSSPND
PVTNICQAADKQLFTLVEWAKRVPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDG
ILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGL
SNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIG
DTPIDTFLMEMLEAPHQMT
NT seq 1320 nt   +upstreamnt  +downstreamnt
atggccgccccctcgctgcacccctccctggggcccggcatcggctcctcgctcggctcc
cccggacagctgcactcgcccatcagcaccctgagctcccccatcaacggcatgggcccg
cccttctcggtcatcagctcccccatgggcccccactccttgtcggtgcccaccaccccc
accctgggcttcggcaccggcagcccccagctcagctcgcccatgaacccggtcagcagc
agcgaggacatcaagcccccgctgggcatcaacggggtcctcaaagtcccggcccacccc
tcagggaacatggcgtccttcaccaagcacatctgtgccatctgtggggaccgctcctca
ggcaagcactacggggtgtacagctgcgagggctgcaagggcttcttcaaacggacggtg
cgcaaggacctgacctacacgtgccgcgacaacaaggactgcctgatcgacaagcgccag
cggaaccggtgccagtactgccgctaccagaagtgcctggccatgggcatgaagcgtgaa
gccgtgcaggaggagcggcagcggggcaaggaccgcggagagaacgaggtggagtccacg
agcagcgccaacgaggacatgccggtggagaagatcctggaggccgagctggccgtcgag
cccaagaccgagacgtacgtggaggcgaacgtggggctgaaccccagctcgcccaatgac
cccgtcaccaacatctgccaagcggccgacaagcagctcttcaccctggtggagtgggcc
aagcgggtcccgcacttctccgagctgcccctggacgaccaggtcatcctgctgagggca
ggctggaacgagctgctcatcgcctccttctcgcaccgctccatagccgtgaaggacggc
atcctcctggccaccgggctgcacgtgcaccgcaacagcgcccacagcgcgggggtgggc
gccatctttgacagggtgctgacggagctggtgtccaagatgagggacatgcagatggac
aagacggagctcggctgcctgcgcgccatcgtcctcttcaacccggactccaagggactc
tcgaacccggccgaggtggaggcccttcgcgagaaggtctacgcgtccctggaggcgtac
tgcaaacacaagtaccccgagcagcccggaaggttcgccaagctgctgctgcgcctgccg
gctctgcgctccatcggcctcaagtgcctggaacacctcttcttcttcaagctcatcggg
gacacgcccatcgacaccttcctcatggagatgctggaggccccccaccaaatgacctag

KEGG   Sus scrofa (pig): 445465
Entry
445465            CDS       T01009                                 

Gene name
RXRG
Definition
(RefSeq) retinoic acid receptor RXR-gamma
  KO
K08526  retinoid X receptor gamma
Organism
ssc  Sus scrofa (pig)
Pathway
ssc03320  PPAR signaling pathway
ssc04659  Th17 cell differentiation
ssc04919  Thyroid hormone signaling pathway
ssc04920  Adipocytokine signaling pathway
ssc04928  Parathyroid hormone synthesis, secretion and action
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05216  Thyroid cancer
ssc05222  Small cell lung cancer
ssc05223  Non-small cell lung cancer
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    445465 (RXRG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    445465 (RXRG)
   03320 PPAR signaling pathway
    445465 (RXRG)
   04919 Thyroid hormone signaling pathway
    445465 (RXRG)
   04928 Parathyroid hormone synthesis, secretion and action
    445465 (RXRG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    445465 (RXRG)
   05202 Transcriptional misregulation in cancer
    445465 (RXRG)
  09162 Cancer: specific types
   05226 Gastric cancer
    445465 (RXRG)
   05216 Thyroid cancer
    445465 (RXRG)
   05222 Small cell lung cancer
    445465 (RXRG)
   05223 Non-small cell lung cancer
    445465 (RXRG)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    445465 (RXRG)
Nuclear receptors [BR:ssc03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   445465 (RXRG)
SSDB
Motif
Pfam: Nuc_recep-AF1 Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 445465
NCBI-ProteinID: NP_001123685
Ensembl: ENSSSCG00000006328
Vega: OTTSUSG00000000640
UniProt: Q0GFF6
LinkDB
Position
4
AA seq 463 aa
MYGNYSHFMKFPTGFGGSPGHSGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVG
TPLNALGSPYRVITSTMGPPSGTLAAPPGINLVAPPSSQLNVVNSVSISEDIKPLPGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECASSGHEDMPVERIL
EAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
TQMDKSELGCLRAVVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgtatggaaattattctcacttcatgaagtttcccacaggcttcggcggctcccctggc
cactctggctccacgtccatgagcccatcagcagccttgtccacagggaagccaatggac
agccaccccagttacaccgacacaccagtgagtgccccacggaccctgagtgcggtgggg
acccccctcaatgccctgggctctccataccgggtcatcacttctactatgggcccacct
tcaggaacgctggcagcccctccaggaatcaatctggttgccccacccagctctcagcta
aatgtggtcaacagtgtcagcatttcagaggacatcaaacccttacccgggcttcctggc
attggaaacatgaactacccgtccaccagccctggatctctggttaaacacatctgtgcc
atctgtggggacagatcctcaggaaagcactacggtgtgtacagttgtgaaggctgcaaa
gggttcttcaagagaaccataaggaaggacctcatctacacctgtcgggataataaagac
tgcctcattgacaagcgccagcgcaaccgctgccagtactgtcgctatcagaagtgcctt
gtcatgggcatgaagagggaagctgtgcaagaagaaaggcagagaagccgggagagggct
gagagtgaggccgaatgtgccagtagtggccatgaagatatgcctgtggagaggattctg
gaagctgaacttgctgttgaaccaaagacggaatcctatggtgacatgaacatggagaat
tcgacgaatgaccctgtcaccaacatatgccacgctgctgataagcagctctttactctc
gttgaatgggccaagcgtattccccacttctctgacctcaccttggaggaccaggtcatt
ctgctccgggcagggtggaatgaattgctgatcgcctccttttcccaccgatcggtttct
gtgcaggacggcatcctcctggccacgggtttacacgtccaccggagcagtgcccacagt
gctggggttggctccatctttgacagagtcctgactgagctggtctccaaaatgaaagac
acgcagatggataagtcggagctggggtgcctgcgagccgtcgtgctatttaacccagat
gccaagggtctgtccaacccctcagaggtagagactctgcgagagaaggtttatgccacc
ctcgaggcctacaccaagcagaagtatccagaacagccgggcaggtttgccaagctgctg
ctgcgcctcccagccctgcgctccatcggcttgaagtgcctggagcaccttttcttcttc
aagctcatcggggacacgcccattgacaccttcctcatggagatgttggagaccccgctg
cagatcacctga

DBGET integrated database retrieval system