KEGG   Sus scrofa (pig): 100156860
Entry
100156860         CDS       T01009                                 

Gene name
BCL2A1
Definition
(RefSeq) bcl-2-related protein A1
  KO
K02162  hematopoietic Bcl-2-related protein A1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04064  NF-kappa B signaling pathway
ssc04210  Apoptosis
ssc05202  Transcriptional misregulation in cancer
ssc05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100156860 (BCL2A1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100156860 (BCL2A1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100156860 (BCL2A1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100156860 (BCL2A1)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 100156860
NCBI-ProteinID: NP_001157983
Ensembl: ENSSSCG00000001778
UniProt: A0A4X1UQW5 C7F841
LinkDB
Position
7
AA seq 175 aa
MTDDEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLRDVAFSVQNEVEKNLKPCLDNFD
VVSIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFEGILMKKLLRKRIAPDVDTYKEISY
FVAEFITKNTGQWIRQNGGWENGFVKKFEPKSGWLTFVEVTGKICEMLCLLKQYY
NT seq 528 nt   +upstreamnt  +downstreamnt
atgactgacgacgagtttggatatattcacatgctggcccaggactatctgaagtatgtc
ctgcagataccacaacctggatctggtccaagcaaaacatctagagtgttacgagacgtg
gctttctccgtccaaaacgaagttgaaaagaatttgaaaccatgcttggacaattttgat
gttgtgtccatagacactgccagaataatattcaatcaagtgatggaaaaggaatttgaa
gatggcatcattaactggggaaggattgtgaccatatttgcatttgaaggtattctcatg
aagaaacttctgcgaaagcgaattgccccagatgtggacacgtacaaggagatttcttac
tttgtcgccgagttcatcaccaaaaacacaggacagtggataaggcaaaacggaggctgg
gaaaatggctttgtaaagaagtttgaacccaaatctggctggctgacctttgtggaagtt
acaggaaagatctgtgaaatgttatgtctcctgaagcaatactattga

DBGET integrated database retrieval system