KEGG   Sus scrofa (pig): 100157080Help
Entry
100157080         CDS       T01009                                 

Gene name
GYS2
Definition
(RefSeq) glycogen [starch] synthase, liver
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00500  Starch and sucrose metabolism
ssc01100  Metabolic pathways
ssc04151  PI3K-Akt signaling pathway
ssc04152  AMPK signaling pathway
ssc04910  Insulin signaling pathway
ssc04922  Glucagon signaling pathway
ssc04931  Insulin resistance
Module
ssc_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100157080 (GYS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100157080 (GYS2)
   04152 AMPK signaling pathway
    100157080 (GYS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100157080 (GYS2)
   04922 Glucagon signaling pathway
    100157080 (GYS2)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    100157080 (GYS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ssc01003]
    100157080 (GYS2)
Enzymes [BR:ssc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     100157080 (GYS2)
Glycosyltransferases [BR:ssc01003]
 Polysaccharide
  Storage polysaccharide
   100157080 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 100157080
NCBI-ProteinID: NP_001182440
Ensembl: ENSSSCG00000000577
UniProt: E0X6R4
LinkDB All DBs
Position
5
AA seq 702 aa AA seqDB search
MLRDRSLSVTSLGGLPRWEAELPVEDLLLFEVSWEVTNKVGGIYTVIQTKAKTTADEWGE
NYFLIGPYFEHNMKTQVEQCEPVNDAVSKAVDTMNKHGCQVHFGRWLIEGSPYVVLFDIG
YSAWNLDKWKGDLWEACNVGIPYHDQEANDMLIFGSLTAWLLKEVTDHADGKHVIAQFHE
WQAGTGLILSRARKLPIATVFTTHATLLGRYLCAANIDFYNHLDKFNIDKEAGERQIYHR
YCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLNVKKFSAVHEFQNLHAMYK
ARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRLNFLLRVHKSDVT
VVVFFIMPAKTNNFNVETLKGQAVRKQLWDTAHSVKEKFGKKLYDALLRGEIPDMNNILD
RDDLTIMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNSRTDRVKVILHPEF
LSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQEH
VADPTAYGIYIVDRRFRSPDDSCNQLTQFLYGFCKQSRRQRIIQRNRTERLSDLLDWRYL
GRYYQHARHLTLSRAFPDKFHMEPTSPPTTEGFKYPRPSSVPPSPSGSQVSSPQSSDAED
ENEDERYDGEEEAERDRLNIKSPFSLGRVPRGKKKLHGEYKN
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgagaccggtccctatcggtgacatccttgggtgggctgcctcggtgggaagct
gagcttcctgtggaagatttactgctctttgaagtgtcttgggaagtgaccaataaagtt
ggcggcatctatactgtgatccagacaaaggccaaaacgacagcagatgaatggggagag
aattattttctgattggtccatattttgagcataatatgaagactcaggtggaacagtgt
gaacctgtcaatgacgctgttagcaaagctgtggacacgatgaataaacacggctgccag
gtgcactttggaagatggctgatagaagggagtccttatgtggtgctctttgacataggc
tactcagcttggaacctggacaagtggaaaggtgacctctgggaagcatgcaatgtcggc
attccttatcatgaccaagaagccaatgatatgctgatatttggatccttaactgcctgg
ctcttaaaagaggtgacagatcatgcagacgggaaacacgtcattgcccaatttcatgaa
tggcaggcagggactggactgatcctttctcgagcccggaaacttccgatcgctacggta
tttaccacccacgccacgctgcttgggaggtatctctgtgcggcaaacatagatttctac
aaccatctcgataagtttaacatagacaaagaggctggagagaggcagatttaccaccgg
tactgcatggagcgcgcttctgtccattgtgctcatgtgttcaccacagtttccgaaata
acagcaatagaggcagaacatatgctgaagagaaagcctgacgtagttacaccaaatggc
ttgaatgttaagaaattttcagcagtacatgaatttcaaaacctacatgccatgtacaag
gctagaatccaagattttgttcgaggtcatttctatggtcacctggactttgatctggaa
aaaacattgttcctcttcattgctgggaggtacgagttttcaaataaaggagctgacatc
ttcctggaatccttatccaggctaaattttctgctgcgggtgcataaaagtgatgtcacc
gtggtggtgtttttcattatgcctgccaagacaaataatttcaatgtggaaaccctgaaa
ggccaggcagtgcgaaaacagctctgggacactgcacattctgtgaaggaaaagtttgga
aagaaactgtatgatgcattattaagaggagaaattcctgacatgaacaatattttggat
cgagacgatttgacaattatgaaaagagccatcttttcaactcagcggcagtccttgccc
ccagtgaccactcacaacatgattgatgactccactgatcccatcctcagcactattaga
cggatcgggcttttcaacagccgcacagacagagtcaaggtgattttgcacccagagttt
ctatcctccaccagccccttgttacccatggattatgaagagtttgttcgaggttgtcat
cttggggtatttccatcatactatgaaccctggggttatactccagccgaatgcactgtg
atgggtatccccagtgtgaccaccaacctctccggctttggctgtttcatgcaagagcat
gtggctgatcccactgcgtatggtatctacattgttgacaggcggttccgctctccggat
gattcttgcaatcagctgactcagtttctctatggattttgcaaacagtcacgacgccag
aggattattcagaggaaccgaactgagaggctttcagaccttctggattggagatactta
ggcagatattaccagcatgccaggcacctgacgttaagcagagcttttccagataaattc
cacatggaacccacatcaccaccaacgacggaagggtttaaataccccaggccttcctca
gtgccaccttccccttcagggtctcaggtctccagtcctcagagcagtgacgcggaggat
gagaatgaagacgagagatacgatggggaagaggaggccgaaagggatcggttaaatatc
aagtcacccttttctctgggccgtgttcctcgggggaagaagaaactgcatggagaatac
aagaactga

DBGET integrated database retrieval system