KEGG   Sus scrofa (pig): 100157336
Entry
100157336         CDS       T01009                                 

Gene name
PML
Definition
(RefSeq) LOW QUALITY PROTEIN: protein PML
  KO
K10054  probable transcription factor PML
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04120  Ubiquitin mediated proteolysis
ssc04144  Endocytosis
ssc05164  Influenza A
ssc05168  Herpes simplex virus 1 infection
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100157336 (PML)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100157336 (PML)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100157336 (PML)
   05202 Transcriptional misregulation in cancer
    100157336 (PML)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100157336 (PML)
  09172 Infectious disease: viral
   05164 Influenza A
    100157336 (PML)
   05168 Herpes simplex virus 1 infection
    100157336 (PML)
Ubiquitin system [BR:ssc04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    100157336 (PML)
SSDB
Motif
Pfam: DUF3583 zf-B_box zf-RING_5 DUF3584 Exonuc_VII_L Imm71
Other DBs
NCBI-GeneID: 100157336
NCBI-ProteinID: XP_001925607
UniProt: M3UZA5
LinkDB
Position
7
AA seq 874 aa
MQQEPAPARSPGPQQNPVLPQAPTMPPPEXPTEGHQPSPSPSPTEQAMEEEFQFLRCQGC
RKEAKCPKLLPCLHTLCSGCLPQPGLQCPICQAPWPQGADTQALDNVFFESLQRRLSVYR
QIMDSQALCTRCKEPANYWCFECEQLLCAKCVEAHQWFLKHEARPLAELRSQSVGEFLDC
TRKSNNIFCSNPNHRSPALTSIYCRGCSKPLCCSCALLDTSHSELKCDIGMEIQQRQEEL
DTMTQALQEQDHAFGAAQAQMRSAVSQLGRVRTDTEELIHARVRQVVAHVLAQEQELLEG
VNARYQRDYEEIASQLSRLDAVLQRIRVGSALVQRMKRYASDQEVLDMHSFLRQALHSLS
QEEPQKLRAAVRTDSFDEFKVRLQDLVSCITQGTDAAVSRRASPEATSTPRDTSDVDLPE
EVQRAQGQTPELAVVQPVPGAHPVPVYAYSIKDPSCREESSSTATPQKRKSCQTEAPRKV
IKMESEVEEERARNSPEQPRPSTSKAVSPPHLDGPLSPKSPTKGNELFWPDSNHVTGNNP
GEAEERVVVISSSEDSDAENSSSQEQDNSSSEASDLQLEGPSSLGVLDESLINSGAEDRP
LVFFDLKIDSETQKISQLAAVNQESQFRMLIQPEAFTIRSKAVSLEVGLQHFLHFLGNMR
QPILACYKLWGPGLPSLFRALEDMNRLQEFRKAISGFLAILPLIRECVPGASSFKLKNLA
ETYLARNMNETRSALASVVTMRDLCRLLEVTPGPQLGPHIHSFSCLQCFSSLQPLVRAAV
LPRAKARLLALHKVSFLELVTAHHHDPQEGLKKYNCFLSPQSPSSPPTQSAFNLQALGTY
FDKGLREGLASTKAEGSSSLLTDHSLVERASQES
NT seq 2625 nt   +upstreamnt  +downstreamnt
atgcagcaggaaccggcacccgcccgatctccggggccccagcagaaccccgtactgccc
caggcccccaccatgccgcccccggagncccccaccgaaggacaccagcccagccccagc
cccagccccacagagcaagccatggaagaagagttccagttcttgcgctgccagggctgc
cggaaggaagccaaatgccccaagctgctaccttgtctgcacacgctgtgttcaggatgc
ctgccgcagccgggcttgcagtgccccatctgccaggcaccctggccccaaggcgctgac
acgcaggccctggataacgtcttcttcgagagcctgcagcggcgcctgtccgtgtaccgg
cagatcatggattcgcaggcgctttgcacccgctgcaaagaaccagccaactactggtgc
tttgagtgtgagcagctcctctgcgccaagtgtgtcgaggcgcatcagtggttcctcaag
cacgaggccaggccgctggccgagctccgcagccagtcggtcggcgagttcctggactgc
acgcgcaagtcaaacaacatcttctgctccaaccccaaccaccgcagccctgcgctgact
agcatctactgccgaggctgttccaagccgctgtgctgttcctgcgcactcctggatacc
agccacagcgagcttaagtgtgacattggcatggagatccagcagcggcaggaggagctg
gacaccatgacgcaggcgctgcaggagcaggatcacgcttttggcgcggcgcaagcgcag
atgcgctcggctgtcagccagctgggccgcgtgcgcaccgacaccgaggagcttatccac
gcgcgtgtgcgccaggtagtagcgcacgtgctggctcaggagcaggagctgctggaaggg
gtgaacgcgcggtatcagcgcgactacgaagagatagcaagccagctgagccgcctggac
gctgtgctgcagcgcatccgcgtgggcagcgcccttgtgcagaggatgaagcgctatgcc
tcggaccaggaggtgctggacatgcacagcttcctgcgccaggcgctccacagcctgagc
caggaggagccccagaagctgagagccgccgtgcgcaccgatagcttcgacgaattcaag
gtgcgcctgcaggacctcgtctcttgcatcacccagggcacagatgcagctgtatccagg
agagccagcccggaggccaccagcacacccagagacacttctgatgttgacctgccagag
gaggtgcagagggcccaagggcagaccccggaattggctgtagtccagccggtgccgggg
gcacaccctgtgccagtgtatgcctactccatcaaagacccctcgtgcagagaggagagc
tccagcacagccacaccacagaagaggaagtcctgccaaactgaggcccccaggaaggtc
atcaagatggagtcagaagtggaggaggagagggctcggaactcccccgagcagcccagg
cccagcacctctaaggcagtctcaccaccccacctggacgggcccctcagccccaagagc
cccaccaaaggaaatgagctcttctggcctgacagcaaccacgtgactggcaacaacccc
ggggaggcagaggagcgcgtcgtggtgatcagcagctcagaagactcagatgctgaaaac
tcgtcctcccaagagcaggacaacagcagcagcgaggccagtgacctccagctggagggc
cccagctccctcggggtcctggacgagagcctcatcaactccggagcagaagacaggccc
ctggttttctttgacctcaagattgacagtgaaacccagaaaattagccagctggcggcc
gtgaaccaagaaagccagttccgcatgctcatccagcccgaagccttcaccatccgttcc
aaggctgtctccctggaggtggggctgcagcacttcctgcacttcctgggcaacatgcgc
caacccatcctcgcctgctataagctgtgggggcctggcctccccagcctcttccgggcc
ctggaggacatgaacaggctgcaggagttccggaaggccatctctggcttcctggccatc
ctgcccctcatccgggagtgcgtgcctggggccagcagcttcaaactcaagaatctggcc
gagacctacctggcaagaaacatgaacgagacgcgcagtgccctggcatccgtggtgacc
atgcgtgacctgtgccgcctcctcgaggtgaccccgggcccccagctgggcccgcacatc
cactccttcagctgcctgcagtgcttctcatctctgcagcctctggtgcgggcagccgtc
ctgccccgggccaaggcccgcttgctggccctccacaaggtcagcttcctggagctggtg
actgcacatcatcatgacccacaagagggcctgaagaagtacaactgcttcctgagccct
cagagtccctcatcgccccccacccagtctgctttcaacctgcaggctctgggcacctac
ttcgacaaaggcctgcgggaggggctggcctccacgaaggcagaaggcagctccagcctc
ctcactgaccacagcttggtggaaagggcttcccaggagagctga

KEGG   Sus scrofa (pig): 396709
Entry
396709            CDS       T01009                                 

Gene name
RARA
Definition
(RefSeq) retinoic acid receptor alpha isoform X2
  KO
K08527  retinoic acid receptor alpha
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04659  Th17 cell differentiation
ssc04915  Estrogen signaling pathway
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    396709 (RARA)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    396709 (RARA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    396709 (RARA)
   05202 Transcriptional misregulation in cancer
    396709 (RARA)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    396709 (RARA)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    396709 (RARA)
Nuclear receptors [BR:ssc03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   396709 (RARA)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 396709
NCBI-ProteinID: XP_003131521
Ensembl: ENSSSCG00000017475
UniProt: A0A287BAX0 A0A4X1UBA7
LinkDB
Position
12
AA seq 459 aa
MYESVDVGGLTPTPSPFLVVDFYNQNRACLLPEKGLPAPGPYSTPLRTPLWNGSNHSIET
QSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYT
CHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEAPKPECSESYTLTPE
VGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFA
KQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFG
PLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYV
RKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTL
SGQAGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgtacgagagtgtggacgtgggggggctcacccccacccccagtcccttcctggtggtg
gatttttataaccagaaccgggcctgtttgctcccggagaaggggctccccgcccccggc
ccctactccaccccgctccggactccgctttggaatggctcaaaccactccattgagacc
cagagcagcagttccgaagagatagtgcccagccctccctcgccgccccccctcccccgc
atctacaagccttgctttgtctgtcaagacaaatcctcaggctaccactatggggtcagc
gcctgtgagggctgcaagggcttcttccgccgaagcatccagaagaacatggtgtacacg
tgtcaccgggacaagaactgcatcatcaacaaggtgacccggaaccgctgccagtactgc
cggctgcagaagtgctttgaagtgggcatgtccaaggagtccgtgaggaacgaccggaac
aagaagaagaaggaggcgcccaagcccgagtgctccgagagctacacgctgacgccggag
gtgggggagctcatcgagaaggtgcgcaaagcgcatcaggagaccttccccgccctctgc
cagctgggcaaatacactacgaacaacagctccgagcagcgcgtctctctggacattgac
ctctgggacaagttcagtgaactctccaccaagtgcatcattaagacggtggagttcgcc
aagcagctgcccggcttcaccaccctcaccatcgccgaccagatcaccctcctcaaggct
gcctgcctggacatcctgatcctgcggatctgcacgcggtacacgcctgagcaggacaca
atgaccttctcagacggactgaccttgaaccggacccagatgcacaacgccggctttggg
cctctcacggacctggtcttcgccttcgccaaccagctgctgcccctggagatggatgat
gctgagactgggctgctcagtgccatctgcctcatctgtggagaccggcaggacctggag
cagccagacagggtggacatgctgcaggagccactgcttgaggcactgaaggtctatgtg
cggaaacggaggcccagccgcccacacatgttccccaagatgctgatgaagatcacagac
ctgcgaagcatcagtgctaagggggccgagcgggtgatcacgctgaagatggagatcccg
ggctccatgccacctctcatccaggaaatgctggagaactcagagggcctggacactctg
agcggacaagcggggggcggggggcgggacgggggcggcctggccccgccgcctggcagc
tgcagccccagcctcagccccagctcgaacagaagcagcccggccacccactccccgtga

DBGET integrated database retrieval system