KEGG   Sus scrofa (pig): 100157564
Entry
100157564         CDS       T01009                                 

Gene name
CEBPE
Definition
(RefSeq) CCAAT/enhancer-binding protein epsilon
  KO
K10051  CCAAT/enhancer binding protein (C/EBP), epsilon
Organism
ssc  Sus scrofa (pig)
Pathway
ssc05202  Transcriptional misregulation in cancer
ssc05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100157564 (CEBPE)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100157564 (CEBPE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    100157564 (CEBPE)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   C/EBP-like factors
    100157564 (CEBPE)
SSDB
Motif
Pfam: bZIP_2 bZIP_1 Taxilin ATG16 Myc-LZ GAS UPF0449 Nmad5 SBE2 DUF2605 DUF2514 Fib_alpha
Other DBs
NCBI-GeneID: 100157564
NCBI-ProteinID: XP_001924449
Ensembl: ENSSSCG00000002033
Vega: OTTSUSG00000002451
UniProt: F1S9D2
LinkDB
Position
7
AA seq 282 aa
MSHGTYYECEPRAGQQPLEFSGARAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAV
KPAPEARGLKGPGTPAFPHYLQPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAAVA
VKEEPRGPEGSRGASRSGYNPLQYQVAHCGQTAMHLPPTLAAPSQPLRVLKAPLATAAPP
CSPLLKAPSPAGPSHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEY
MAENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS
NT seq 849 nt   +upstreamnt  +downstreamnt
atgtcccacgggacctactacgagtgtgagccccgggctggccagcagccactcgagttc
tcgggggcccgagcggggcctggggagctaggggacatgtgtgagcatgaggcctccatc
gacctatctgcctacatcgaatctggggaggaacagctcctctccgacctcttcgctgtg
aagccagcacctgaggcccgaggcctgaagggccccggaacccctgccttcccccactat
ctgcagcctgaccctcggcccttcgcctaccccccacataccttcggccccgacaggaag
gccttggggcctggcatctacagcagcccggggagctacgaccccagagccgccgtggcc
gtgaaggaggagcctcgggggcctgagggcagccggggggccagccgcagcggctacaac
cctctgcagtaccaagtggctcactgtgggcagacggccatgcacctgcccccgaccctg
gcagcacccagccagcccctacgtgtcctcaaggcccctctggccactgctgcacccccc
tgcagccccctcctcaaggcgccctccccagctggcccctcacacaagggcaagaaggcc
gtgaacaaagacagcctggagtaccggctgcggcgggagcgaaacaacattgccgtgcgg
aagagccgggacaaggccaagaggcgcattctggagacgcagcagaaggtgctggaatac
atggccgagaacgagcgtctgcgcagtcgggtggagcagctgacccaggagctggacaca
ctccgcaacctcttccgccagatccctgaggctgccaacctcatcaagggtgtggggggc
tgcagctga

DBGET integrated database retrieval system