KEGG   Sus scrofa (pig): 100157842
Entry
100157842         CDS       T01009                                 

Gene name
BTRC
Definition
(RefSeq) F-box/WD repeat-containing protein 1A isoform X5
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04114  Oocyte meiosis
ssc04120  Ubiquitin mediated proteolysis
ssc04218  Cellular senescence
ssc04310  Wnt signaling pathway
ssc04340  Hedgehog signaling pathway
ssc04390  Hippo signaling pathway
ssc04710  Circadian rhythm
ssc05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100157842 (BTRC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100157842 (BTRC)
   04340 Hedgehog signaling pathway
    100157842 (BTRC)
   04390 Hippo signaling pathway
    100157842 (BTRC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100157842 (BTRC)
   04218 Cellular senescence
    100157842 (BTRC)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    100157842 (BTRC)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100157842 (BTRC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ssc04121]
    100157842 (BTRC)
   03036 Chromosome and associated proteins [BR:ssc03036]
    100157842 (BTRC)
Ubiquitin system [BR:ssc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     100157842 (BTRC)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     100157842 (BTRC)
SSDB
Motif
Pfam: WD40 Beta-TrCP_D F-box-like ANAPC4_WD40 F-box Nup160 WD40_like F-box_5 DUF4508 WD40_2 PAN_3
Other DBs
NCBI-GeneID: 100157842
NCBI-ProteinID: XP_001924863
Ensembl: ENSSSCG00000010563
UniProt: A0A287AQ79 A0A4X1U248
LinkDB
Position
14
AA seq 579 aa
MDPAEAVLQEKALKFMCSMPRSLWLGCSSLADSMPSLRCLYNPGTGALTAFQTYNSCARL
CLNQETVCLASTAMKTENCVAKTKLANGTSSMIVPKQRKLSASYEKEKELCVKYFEQWSE
SDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDFITALPARGLDHIAENILSYLDAKSLC
AAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGWGQYLFKNKPPDGNAPPNS
FYRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIK
IWDKSTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAV
LHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDR
TIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHE
ELVRCIRFDNKRIVSGAYDGKIKVWDLIAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEF
QIVSSSHDDTILIWDFLNDPAAQAEPPRSPSRTYTYISR
NT seq 1740 nt   +upstreamnt  +downstreamnt
atggacccggccgaagcggtgctgcaggaaaaagcgctcaagtttatgtgctctatgccc
aggtctctgtggctgggctgctccagcctggcggacagcatgccttcgctgcgatgcctg
tataacccagggactggcgcactcacagctttccagacttacaacagctgtgccagactc
tgcttaaatcaagagacagtatgtctagcaagcactgctatgaagactgaaaactgtgtg
gccaaaacaaaacttgccaatggcacttccagtatgattgtgcccaagcaacggaaactc
tcagcaagctatgagaaggaaaaggaactgtgtgtcaaatattttgagcagtggtcagag
tctgatcaagtggaatttgtggaacatcttatatcccaaatgtgtcattaccaacatggg
cacataaactcctatcttaaacctatgttgcagagggatttcataactgccctgccagct
cggggtttggatcacattgctgagaacattctgtcatacctggatgccaaatcactatgt
gctgctgaacttgtgtgcaaggaatggtaccgagtgacatctgatggaatgctatggaag
aagctcatcgagcgaatggtcaggacagattctctgtggagaggcctggcagaacggaga
gggtggggacagtatttattcaaaaacaaacctcctgatgggaatgctcctcccaactct
ttttatagagcactttatcctaaaattatacaagacattgagacgatagaatctaattgg
cgatgtggaagacatagcttacagagaatccactgccgaagtgaaacgagcaaaggagtc
tactgtttacagtatgatgatcagaagatagtaagtggccttcgagacaacacaatcaag
atctgggataaaagcacattggaatgcaagcgaattctcacaggccacacaggttctgtc
ctgtgtctccagtatgatgagagggtgatcataactggatcgtcggattccacagtcagg
gtgtgggatgtaaatacaggtgaaatgctaaacacattgattcaccattgtgaagctgtt
ctgcacttgcgtttcaataatggcatgatggtgacctgctccaaagaccgttccattgcg
gtatgggatatggcctccccaactgacatcaccctccggagggtacttgttggacaccga
gctgcagtcaatgttgtggactttgatgacaagtacatcgtttctgcatctggggacagg
actataaaggtatggaacacaagtacttgtgaatttgtacggaccttaaatggacacaaa
cgtggaattgcctgtttgcagtacagagataggctggttgtgagtggctcatctgacaac
actatcagattatgggacatagaatgtggtgcatgcttacgagtattagaaggccatgag
gaattggtgcgctgtattcgatttgataataagaggatagtcagtggagcctatgatgga
aaaattaaagtgtgggatcttatagctgctttggatccccgtgctcctgcaggaactctc
tgtcttcggacccttgtggagcattctggaagagttttccggctccagtttgatgaattc
cagattgtcagtagttcacatgatgacacaatcctcatctgggacttcctaaatgatcca
gctgcccaagctgaacccccccgctccccttctcgcacatacacctatatctccagatag

KEGG   Sus scrofa (pig): 100523218
Entry
100523218         CDS       T01009                                 

Gene name
FBXW11
Definition
(RefSeq) F-box/WD repeat-containing protein 11 isoform X1
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04114  Oocyte meiosis
ssc04120  Ubiquitin mediated proteolysis
ssc04218  Cellular senescence
ssc04310  Wnt signaling pathway
ssc04340  Hedgehog signaling pathway
ssc04390  Hippo signaling pathway
ssc04710  Circadian rhythm
ssc05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100523218 (FBXW11)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100523218 (FBXW11)
   04340 Hedgehog signaling pathway
    100523218 (FBXW11)
   04390 Hippo signaling pathway
    100523218 (FBXW11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100523218 (FBXW11)
   04218 Cellular senescence
    100523218 (FBXW11)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    100523218 (FBXW11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100523218 (FBXW11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ssc04121]
    100523218 (FBXW11)
   03036 Chromosome and associated proteins [BR:ssc03036]
    100523218 (FBXW11)
Ubiquitin system [BR:ssc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     100523218 (FBXW11)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     100523218 (FBXW11)
SSDB
Motif
Pfam: WD40 Beta-TrCP_D ANAPC4_WD40 F-box-like F-box WD40_like Nup160 DUF1513 WD40_2 DUF4508
Other DBs
NCBI-GeneID: 100523218
NCBI-ProteinID: XP_020932774
Ensembl: ENSSSCG00000023307
LinkDB
Position
16
AA seq 563 aa
MEPDSVIEDKTIELMCSVPRSLWLGCANLVESMCALSCLQSMPSVRCLQNTSVMEDQNED
ESPKKNTLWQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSESDQVEFVEHLISRM
CHYQHGHINSYLKPMLQRDFITALPEQGLDHIAENILSYLDARSLCAAELVCKEWQRVIS
EGMLWKKLIERMVRTDPLWKGLSERRGWDQYLFKNRPTDGPPNSFYRSLYPKIIQDIETI
ESNWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGH
TGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKD
RSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTL
NGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSG
AYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDF
LNVPPSAQNETRSPSRTYTYISR
NT seq 1692 nt   +upstreamnt  +downstreamnt
atggagcccgactcggtgattgaggacaagaccatcgagctcatgtgttctgtgccaagg
tctttgtggctaggctgcgccaacctggtagagagcatgtgcgcactgagttgcctgcag
agcatgcccagtgtcagatgtctccagaacacttcagttatggaggatcaaaatgaagat
gagtccccaaagaaaaatactctttggcagataagtaatggaacatcatcagtgatcgtc
tccagaaagaggccctcagaaggaaactatcaaaaagaaaaagacttgtgtattaaatat
tttgaccagtggtctgaatcagatcaagtggaatttgtggaacaccttatttcacgaatg
tgtcattaccagcatggacatattaactcttacctgaagcccatgttgcagcgggacttc
attaccgctttaccagagcaaggcttagatcacatagcagaaaacattctttcctacctg
gatgccaggtctctgtgtgcagcagagctggtgtgtaaagaatggcagcgagtgatctcc
gaaggcatgctgtggaagaagctgatcgaacgaatggtgcgcactgaccctctatggaag
ggactttcagaaagaagagggtgggatcagtacctgtttaaaaacagacccacagatggc
cctcccaattcattttataggtcattatacccaaagattatccaggatatagagactata
gaatctaactggcggtgtggacgacacaacttgcagaggattcagtgccgctctgaaaat
agtaaaggtgtctactgtttacagtatgatgatgaaaaaattatcagtggcctacgagat
aattctattaagatttgggataaaaccagcttggaatgtttgaaagtgttaacaggacac
actggctctgtcctttgtctccagtatgatgaacgtgtcattgtgactggctcttcagac
tctacagtgagagtctgggatgtgaacacgggcgaagttctgaacacgttgatccaccac
aacgaggctgtactgcacttacgcttcagcaatggactgatggtgacctgttctaaggac
cgctccatcgcagtgtgggacatggcttctgccactgatatcactttacgccgtgtcctg
gttggccaccgtgctgctgtcaacgtagtagactttgacgataagtacatagtatctgcc
tctggtgacaggaccatcaaagtctggagcacaagcacctgtgaatttgttcgtactctg
aatgggcacaagcgaggcattgcctgtcttcagtacagggatcggctggttgttagtgga
tcatcagataataccataaggctatgggatattgaatgtggtgcctgtttgagagtccta
gagggacatgaagaattggtccgatgcatccgatttgataacaagaggattgtcagtgga
gcgtatgatgggaaaatcaaagtttgggacttgcaagcggctctcgacccccgagcccca
gcaagcacgttgtgtctgcgcacactggtggaacattctggacgtgtgtttcggctacag
tttgatgaatttcagatcatcagcagctcccatgatgacacaattttgatttgggatttc
ttaaatgtgcctcccagtgcccagaatgagacccgttctccctccagaacatacacttac
atctccagataa

DBGET integrated database retrieval system