KEGG   Sus scrofa (pig): 100157844
Entry
100157844         CDS       T01009                                 

Gene name
PIM1
Definition
(RefSeq) serine/threonine-protein kinase pim-1
  KO
K04702  proto-oncogene serine/threonine-protein kinase Pim-1 [EC:2.7.11.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04630  JAK-STAT signaling pathway
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc05200  Pathways in cancer
ssc05206  MicroRNAs in cancer
ssc05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100157844 (PIM1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100157844 (PIM1)
   05206 MicroRNAs in cancer
    100157844 (PIM1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100157844 (PIM1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100157844 (PIM1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100157844 (PIM1)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100157844 (PIM1)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: CAMK group
  PIM family [OT]
   100157844 (PIM1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal APH Choline_kinase Seadorna_VP7
Other DBs
NCBI-GeneID: 100157844
NCBI-ProteinID: XP_005665984
LinkDB
Position
7
AA seq 313 aa
MLLSKINSLAHLRAAPCNDLHATKLAPGKDKEPLESQYQVGPLLGSGGFGSVYSGIRVAD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPSFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
NT seq 942 nt   +upstreamnt  +downstreamnt
atgctcttgtccaaaatcaactcgcttgcccacctgcgcgccgcgccctgcaacgacctg
cacgccaccaagctggcgcccggcaaggataaggagcccctggagtcgcagtaccaggtg
ggcccgctactgggcagcggcggcttcggttcggtctactcaggcatccgtgtcgccgac
aacttgccggtggccatcaagcacgtggagaaggaccggatttccgactggggagaactg
cctaatggcacccgagtgcccatggaagtggttcttctgaagaaggtgagctcgggcttt
tccggcgtcattaggctcctggactggttcgagaggcccgacagtttcgtcctgatcctg
gagaggcccgagccggtgcaagacctcttcgactttatcacggaaaggggggccctgcag
gaggagctggcccgcagcttcttctggcaggtgctggaggccgttcgccactgccacaac
tgcggggtgctccaccgcgacatcaaggacgagaacatcctcatcgacctcaaccgcggc
gagctcaagctcatcgacttcgggtcgggggcgcttctcaaggacaccgtctacacggac
ttcgatggaacccgagtgtatagtcctccagagtggatccgctatcatcgctaccatggc
aggtcagcggcggtctggtctctggggatcctgctgtacgacatggtctgcggagatatt
ccctttgaacatgatgaggagatcatcaggggccaagtgttcttcaggcagagggtctct
tcagagtgtcagcatctcatcagatggtgcttggccttgagaccatcagatcggccatcc
ttcgaagaaatccagaaccatccatggatgcaggatgtccttctgccccaggaaactgct
gagatccatctccacagcctctcaccggggcccagcaaatag

DBGET integrated database retrieval system