KEGG   Sus scrofa (pig): 100170131
Entry
100170131         CDS       T01009                                 

Gene name
CYCS
Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01524  Platinum drug resistance
ssc04115  p53 signaling pathway
ssc04210  Apoptosis
ssc04215  Apoptosis - multiple species
ssc04932  Non-alcoholic fatty liver disease
ssc05010  Alzheimer disease
ssc05012  Parkinson disease
ssc05014  Amyotrophic lateral sclerosis
ssc05016  Huntington disease
ssc05017  Spinocerebellar ataxia
ssc05020  Prion disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05132  Salmonella infection
ssc05134  Legionellosis
ssc05145  Toxoplasmosis
ssc05152  Tuberculosis
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05162  Measles
ssc05163  Human cytomegalovirus infection
ssc05164  Influenza A
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05168  Herpes simplex virus 1 infection
ssc05169  Epstein-Barr virus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05200  Pathways in cancer
ssc05210  Colorectal cancer
ssc05222  Small cell lung cancer
ssc05416  Viral myocarditis
ssc05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100170131 (CYCS)
   04215 Apoptosis - multiple species
    100170131 (CYCS)
   04115 p53 signaling pathway
    100170131 (CYCS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100170131 (CYCS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100170131 (CYCS)
   05222 Small cell lung cancer
    100170131 (CYCS)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100170131 (CYCS)
   05161 Hepatitis B
    100170131 (CYCS)
   05160 Hepatitis C
    100170131 (CYCS)
   05164 Influenza A
    100170131 (CYCS)
   05162 Measles
    100170131 (CYCS)
   05168 Herpes simplex virus 1 infection
    100170131 (CYCS)
   05163 Human cytomegalovirus infection
    100170131 (CYCS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100170131 (CYCS)
   05169 Epstein-Barr virus infection
    100170131 (CYCS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100170131 (CYCS)
   05134 Legionellosis
    100170131 (CYCS)
   05152 Tuberculosis
    100170131 (CYCS)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100170131 (CYCS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100170131 (CYCS)
   05012 Parkinson disease
    100170131 (CYCS)
   05014 Amyotrophic lateral sclerosis
    100170131 (CYCS)
   05016 Huntington disease
    100170131 (CYCS)
   05017 Spinocerebellar ataxia
    100170131 (CYCS)
   05020 Prion disease
    100170131 (CYCS)
   05022 Pathways of neurodegeneration - multiple diseases
    100170131 (CYCS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100170131 (CYCS)
   05416 Viral myocarditis
    100170131 (CYCS)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100170131 (CYCS)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100170131 (CYCS)
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 100170131
NCBI-ProteinID: NP_001123442
Ensembl: ENSSSCG00000016714
UniProt: P62895
LinkDB
Position
18
AA seq 105 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW
GEETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccacact
gtagaaaagggaggcaaacacaagactggtccaaacctccatggtctctttgggcggaag
acaggtcaggctcctggattctcttacacagatgccaacaagaacaaaggcatcacctgg
ggagaggagacactgatggagtacctggagaatcccaagaagtacatccctggaacaaaa
atgatcttcgctggcattaagaagaagggagaaagggaagacttgatagcttatctgaaa
aaagctactaatgagtaa

KEGG   Sus scrofa (pig): 100519295
Entry
100519295         CDS       T01009                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01524  Platinum drug resistance
ssc04115  p53 signaling pathway
ssc04210  Apoptosis
ssc04215  Apoptosis - multiple species
ssc04932  Non-alcoholic fatty liver disease
ssc05010  Alzheimer disease
ssc05012  Parkinson disease
ssc05014  Amyotrophic lateral sclerosis
ssc05016  Huntington disease
ssc05017  Spinocerebellar ataxia
ssc05020  Prion disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05132  Salmonella infection
ssc05134  Legionellosis
ssc05145  Toxoplasmosis
ssc05152  Tuberculosis
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05162  Measles
ssc05163  Human cytomegalovirus infection
ssc05164  Influenza A
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05168  Herpes simplex virus 1 infection
ssc05169  Epstein-Barr virus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05200  Pathways in cancer
ssc05210  Colorectal cancer
ssc05222  Small cell lung cancer
ssc05416  Viral myocarditis
ssc05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100519295
   04215 Apoptosis - multiple species
    100519295
   04115 p53 signaling pathway
    100519295
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100519295
  09162 Cancer: specific types
   05210 Colorectal cancer
    100519295
   05222 Small cell lung cancer
    100519295
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100519295
   05161 Hepatitis B
    100519295
   05160 Hepatitis C
    100519295
   05164 Influenza A
    100519295
   05162 Measles
    100519295
   05168 Herpes simplex virus 1 infection
    100519295
   05163 Human cytomegalovirus infection
    100519295
   05167 Kaposi sarcoma-associated herpesvirus infection
    100519295
   05169 Epstein-Barr virus infection
    100519295
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100519295
   05134 Legionellosis
    100519295
   05152 Tuberculosis
    100519295
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100519295
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100519295
   05012 Parkinson disease
    100519295
   05014 Amyotrophic lateral sclerosis
    100519295
   05016 Huntington disease
    100519295
   05017 Spinocerebellar ataxia
    100519295
   05020 Prion disease
    100519295
   05022 Pathways of neurodegeneration - multiple diseases
    100519295
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100519295
   05416 Viral myocarditis
    100519295
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100519295
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100519295
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 CxC4 DUF3365 Cytochrom_C550
Other DBs
NCBI-GeneID: 100519295
NCBI-ProteinID: XP_003123169
Ensembl: ENSSSCG00000024275
UniProt: I3LNY8 A0A4X1VKU6
LinkDB
Position
2
AA seq 104 aa
MGDVEKNKIFVQKCAQCHTVEKGGKQKTGPNLHGLFGWNTGQTVGFSSVDVNKNKGITWG
EETLREYLEDRKKYIPGTKMIFVSIKKKGEKGDLIAYLKKAASE
NT seq 315 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaagaacaagatttttgttcagaagtgtgcccagtgccatactgtg
gaaaagggaggcaagcagaaaactgggccaaacctccatggtctgtttgggtggaacaca
ggtcagactgttggattctcttccgtagatgtcaacaagaacaaaggcatcacctgggga
gaggagacgctgagggagtacttggaggatcgcaagaagtacatccctggaacaaaaatg
atctttgtcagcattaagaagaagggagaaaagggagacttgatagcttatctcaaaaaa
gctgctagtgaatag

KEGG   Sus scrofa (pig): 100522842
Entry
100522842         CDS       T01009                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01524  Platinum drug resistance
ssc04115  p53 signaling pathway
ssc04210  Apoptosis
ssc04215  Apoptosis - multiple species
ssc04932  Non-alcoholic fatty liver disease
ssc05010  Alzheimer disease
ssc05012  Parkinson disease
ssc05014  Amyotrophic lateral sclerosis
ssc05016  Huntington disease
ssc05017  Spinocerebellar ataxia
ssc05020  Prion disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05132  Salmonella infection
ssc05134  Legionellosis
ssc05145  Toxoplasmosis
ssc05152  Tuberculosis
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05162  Measles
ssc05163  Human cytomegalovirus infection
ssc05164  Influenza A
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05168  Herpes simplex virus 1 infection
ssc05169  Epstein-Barr virus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05200  Pathways in cancer
ssc05210  Colorectal cancer
ssc05222  Small cell lung cancer
ssc05416  Viral myocarditis
ssc05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100522842
   04215 Apoptosis - multiple species
    100522842
   04115 p53 signaling pathway
    100522842
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100522842
  09162 Cancer: specific types
   05210 Colorectal cancer
    100522842
   05222 Small cell lung cancer
    100522842
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100522842
   05161 Hepatitis B
    100522842
   05160 Hepatitis C
    100522842
   05164 Influenza A
    100522842
   05162 Measles
    100522842
   05168 Herpes simplex virus 1 infection
    100522842
   05163 Human cytomegalovirus infection
    100522842
   05167 Kaposi sarcoma-associated herpesvirus infection
    100522842
   05169 Epstein-Barr virus infection
    100522842
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100522842
   05134 Legionellosis
    100522842
   05152 Tuberculosis
    100522842
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100522842
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100522842
   05012 Parkinson disease
    100522842
   05014 Amyotrophic lateral sclerosis
    100522842
   05016 Huntington disease
    100522842
   05017 Spinocerebellar ataxia
    100522842
   05020 Prion disease
    100522842
   05022 Pathways of neurodegeneration - multiple diseases
    100522842
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100522842
   05416 Viral myocarditis
    100522842
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100522842
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100522842
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 DUF4660 CCP_MauG
Other DBs
NCBI-GeneID: 100522842
NCBI-ProteinID: XP_013841086
LinkDB
Position
18
AA seq 86 aa
MGNVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFTYTDANKNKGITW
GEETLMAYLENPKKYIPGTKMIFAGI
NT seq 261 nt   +upstreamnt  +downstreamnt
atgggcaatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccacact
gtagaaaagggaggcaagcacaagactggtccaaacctccatggtctctttgggcggaag
acaggtcaggctcctggattcacttacacagatgccaacaagaacaaaggcatcacctgg
ggagaggagacactgatggcgtacctggagaatcccaagaagtacatccctggaacaaaa
atgatcttcgctggcatttag

KEGG   Sus scrofa (pig): 100621347
Entry
100621347         CDS       T01009                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01524  Platinum drug resistance
ssc04115  p53 signaling pathway
ssc04210  Apoptosis
ssc04215  Apoptosis - multiple species
ssc04932  Non-alcoholic fatty liver disease
ssc05010  Alzheimer disease
ssc05012  Parkinson disease
ssc05014  Amyotrophic lateral sclerosis
ssc05016  Huntington disease
ssc05017  Spinocerebellar ataxia
ssc05020  Prion disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05132  Salmonella infection
ssc05134  Legionellosis
ssc05145  Toxoplasmosis
ssc05152  Tuberculosis
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05162  Measles
ssc05163  Human cytomegalovirus infection
ssc05164  Influenza A
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05168  Herpes simplex virus 1 infection
ssc05169  Epstein-Barr virus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05200  Pathways in cancer
ssc05210  Colorectal cancer
ssc05222  Small cell lung cancer
ssc05416  Viral myocarditis
ssc05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100621347
   04215 Apoptosis - multiple species
    100621347
   04115 p53 signaling pathway
    100621347
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100621347
  09162 Cancer: specific types
   05210 Colorectal cancer
    100621347
   05222 Small cell lung cancer
    100621347
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100621347
   05161 Hepatitis B
    100621347
   05160 Hepatitis C
    100621347
   05164 Influenza A
    100621347
   05162 Measles
    100621347
   05168 Herpes simplex virus 1 infection
    100621347
   05163 Human cytomegalovirus infection
    100621347
   05167 Kaposi sarcoma-associated herpesvirus infection
    100621347
   05169 Epstein-Barr virus infection
    100621347
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100621347
   05134 Legionellosis
    100621347
   05152 Tuberculosis
    100621347
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100621347
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100621347
   05012 Parkinson disease
    100621347
   05014 Amyotrophic lateral sclerosis
    100621347
   05016 Huntington disease
    100621347
   05017 Spinocerebellar ataxia
    100621347
   05020 Prion disease
    100621347
   05022 Pathways of neurodegeneration - multiple diseases
    100621347
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100621347
   05416 Viral myocarditis
    100621347
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100621347
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100621347
SSDB
Motif
Pfam: Cytochrom_C Cytochrom_C550 Cytochrome_CBB3 NCKAP5
Other DBs
NCBI-GeneID: 100621347
NCBI-ProteinID: XP_013851692
UniProt: A0A4X1TFW9
LinkDB
Position
3
AA seq 85 aa
MGDVEQGKKIFVQKSAQCHAVEKGGKHKTGPNLHGLFGQKRGQAPGFSYPDANKNKGITW
GEETLMEYLENSKYIPGMKMIFAGI
NT seq 258 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagcagggcaagaagatttttgttcagaagagtgcccagtgccacgct
gtagaaaagggaggcaagcacaagactggtccaaacctccatggtctctttgggcagaag
agaggtcaggctcctggattctcttacccagatgccaacaagaacaaaggcatcacctgg
ggagaggagacactgatggagtacctggagaattccaagtacatccctggaatgaaaatg
atctttgctggcatttag

DBGET integrated database retrieval system