KEGG   Sus scrofa (pig): 100170851
Entry
100170851         CDS       T01009                                 

Gene name
PTPN11
Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 11 isoform X1
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04014  Ras signaling pathway
ssc04072  Phospholipase D signaling pathway
ssc04360  Axon guidance
ssc04625  C-type lectin receptor signaling pathway
ssc04630  JAK-STAT signaling pathway
ssc04650  Natural killer cell mediated cytotoxicity
ssc04670  Leukocyte transendothelial migration
ssc04722  Neurotrophin signaling pathway
ssc04920  Adipocytokine signaling pathway
ssc04931  Insulin resistance
ssc05168  Herpes simplex virus 1 infection
ssc05205  Proteoglycans in cancer
ssc05211  Renal cell carcinoma
ssc05220  Chronic myeloid leukemia
ssc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100170851 (PTPN11)
   04630 JAK-STAT signaling pathway
    100170851 (PTPN11)
   04072 Phospholipase D signaling pathway
    100170851 (PTPN11)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100170851 (PTPN11)
   04650 Natural killer cell mediated cytotoxicity
    100170851 (PTPN11)
   04670 Leukocyte transendothelial migration
    100170851 (PTPN11)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100170851 (PTPN11)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100170851 (PTPN11)
  09158 Development and regeneration
   04360 Axon guidance
    100170851 (PTPN11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100170851 (PTPN11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100170851 (PTPN11)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100170851 (PTPN11)
   05211 Renal cell carcinoma
    100170851 (PTPN11)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100170851 (PTPN11)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100170851 (PTPN11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ssc01009]
    100170851 (PTPN11)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100170851 (PTPN11)
Protein phosphatases and associated proteins [BR:ssc01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    100170851 (PTPN11)
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 100170851
NCBI-ProteinID: XP_013845815
Ensembl: ENSSSCG00000030289
UniProt: A0A480ERB4
LinkDB
Position
14
AA seq 597 aa
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG
DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGK
EAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYD
VGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETT
DKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEP
VSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEV
ERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRELKLSKVGQALLQGNTERTVW
QYHFRTWPDHGVPSDPGGVLDFLEEVHHKQESIMDAGPVVVHCSAGIGRTGTFIVIDILI
DIIREKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSK
RKGHEYTNIKYSLTDQAGGEQSPLPPCTPTPSCAEMREDNARVYENVGLMQQQKSFR
NT seq 1794 nt   +upstreamnt  +downstreamnt
atgacatcgcggagatggtttcacccaaatatcactggcgtggaggcagaaaacctactg
ttgacaagaggagttgatggcagttttttggcgaggcccagtaaaagcaaccctggagac
ttcacactttccgttagaagaaatggagctgtcacccacatcaagattcagaacactggt
gattactatgacctgtatggaggagagaaatttgccactttggctgagttggtccagtat
tacatggaacatcatgggcaattaaaagagaagaatggagatgttattgagctcaaatat
cctctgaactgtgcagatcctacctctgaaaggtggtttcatggacacctctctgggaaa
gaagcagagaaattattaactgagaaaggaaaacatggtagctttcttgtgcgagagagc
cagagccaccctggggattttgttctctctgtccggacaggagatgacaaaggggagagc
aatgatggcaagtctaaagtgacccacgtcatgatccgctgtcaggaactaaaatatgac
gttggtggaggagaacggtttgactctttgacagatcttgtggagcattacaagaagaat
cctatggtagagacattgggcacagtactacaactcaagcagcccctcaacacaactcgt
atcaatgctgctgaaatagaaagtcgagttcgagaactaagcaaattagctgagaccaca
gataaagtcaaacaaggcttttgggaagaatttgagacactacaacaacaggagtgcaag
cttctctatagccgaaaagagggtcagaggcaagaaaataaaaacaaaaatagatataaa
aacatcctgccctttgatcataccagagtcgtcttacatgatggtgatcccaatgagcct
gtttcagattacatcaatgcaaatatcatcatgcctgaatttgaaaccaagtgcaacaac
tcaaagcccaaaaagagttacattgccacccaaggctgcctgcaaaacacggtgaatgac
ttttggaggatggtatttcaggagaactcccgagtaattgtcatgacaacaaaagaagtg
gagagaggaaagagtaaatgtgtcaaatactggcctgatgagtatgcgctaaaagaatac
ggggtcatgcgcgttaggaacgtcaaagaaagtgccgctcatgactatacattaagagaa
cttaaactttcaaaggtcggacaagctctactccaggggaatacggagagaacggtctgg
caataccactttcggacctggccggaccatggagtgcccagtgaccctgggggcgtgctg
gacttcctggaggaggtccaccacaagcaggagagcatcatggatgcagggcctgtggtg
gttcactgcagtgctggaattggccggacagggacgttcattgtgattgatattcttatt
gacatcatcagagagaaaggtgttgactgcgacatcgacgttcccaaaactattcagatg
gtgcggtctcagaggtcagggatggtccagacagaagcacagtaccgattcatctatatg
gccgtccagcattatattgaaacactacagcgcaggattgaagaagaacagaagagcaag
aggaaagggcacgaatatacaaatattaagtactccctaacggaccaggcaggcggagag
cagagccccctcccgccttgtaccccaacgccatcctgtgcagaaatgagagaagataat
gctagagtctatgaaaatgtgggtctgatgcagcagcagaaaagtttcagatga

KEGG   Sus scrofa (pig): 100620540
Entry
100620540         CDS       T01009                                 

Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 11-like
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04014  Ras signaling pathway
ssc04072  Phospholipase D signaling pathway
ssc04360  Axon guidance
ssc04625  C-type lectin receptor signaling pathway
ssc04630  JAK-STAT signaling pathway
ssc04650  Natural killer cell mediated cytotoxicity
ssc04670  Leukocyte transendothelial migration
ssc04722  Neurotrophin signaling pathway
ssc04920  Adipocytokine signaling pathway
ssc04931  Insulin resistance
ssc05168  Herpes simplex virus 1 infection
ssc05205  Proteoglycans in cancer
ssc05211  Renal cell carcinoma
ssc05220  Chronic myeloid leukemia
ssc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100620540
   04630 JAK-STAT signaling pathway
    100620540
   04072 Phospholipase D signaling pathway
    100620540
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100620540
   04650 Natural killer cell mediated cytotoxicity
    100620540
   04670 Leukocyte transendothelial migration
    100620540
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100620540
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100620540
  09158 Development and regeneration
   04360 Axon guidance
    100620540
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100620540
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100620540
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100620540
   05211 Renal cell carcinoma
    100620540
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100620540
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100620540
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ssc01009]
    100620540
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100620540
Protein phosphatases and associated proteins [BR:ssc01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    100620540
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc PTPlike_phytase Y_phosphatase3 HcgF
Other DBs
NCBI-GeneID: 100620540
NCBI-ProteinID: XP_020953245
Ensembl: ENSSSCG00000025299
LinkDB
Position
6
AA seq 674 aa
MPPGGQWEVTRGGARTVSAFVGQKGQQQADHKPIPVEYVSAWRAHRGSGDEGRWGWVQPA
WPGSLAPPTHCPPSRWFHPNISGVEAEKLLLSRGQHGSFLARPSQSCPGGFTLSVRRHDE
VTHIKIQSTGDYYDLYGGEKFATLAELVQHYTGQHGGLLRERGGAPVELRHPLGCQDPTS
ERWYHGHLSGKEAEKLLTEKGRPGSFLVRESQSKPGDFVLSVLTQLLDKADCQPRVTHIR
IHFQPEGKYDVGGGEQFDTLGDLVEHYRKSPMVERSGAMVHLGQPLKATRIKAASIESRV
QELNKVMDASEKAKQGFWEEFELLQQQECQLLHPRREGQRLENKPKNRYKNILPFDTTRV
VLRDVDKNVPGADYINANYIRSDPEEKPGHGLGKLYIATQGCLQTTVAAFWAMVHQENTR
VIVMTTREVERGRNKCFRYWPELHGSQGYGHLRVRNVAEHWAQGYCVRELQVWQPNQEES
QRVVKHYQYCSWPDHGVPAEPAGVLGFLDEVNRAQNSMPGAGPVVVHCSAGIGRTGTIIV
IDILVDIVRRQGLDCDIDVPKTIQLVRRQRSGMVQTEAQYKFVYLALQRYIQGQQLRLRE
QEAGPVRGGASAGITMVTSGPSPQREPPKEHDSLNVGALPADRGCSPGPAPSPAPEATPE
ASGREYENLLGLRP
NT seq 2025 nt   +upstreamnt  +downstreamnt
atgccccctgggggccagtgggaggtgaccagaggaggggcaagaacagtgtctgccttt
gtggggcagaaaggccagcagcaggcagaccacaagcccatacctgtggagtatgtgtca
gcatggcgggcacaccgcggcagcggggatgagggcagatggggttgggtccagccagca
tggcccggctctctcgcaccaccaactcactgtcctccttccaggtggttccaccccaac
atcagtggggtcgaggcggagaagctgctcctgtccaggggccagcacgggagcttcctg
gcaagacccagccagagctgcccaggtggcttcacgctgtccgtcaggcgccatgacgag
gtgacccacatcaagatccagagcacgggcgactactacgatctctacggaggggagaag
ttcgcgacactggctgagctggtgcagcactacactggccagcacggggggctgctccga
gagcgcggtggggccccggtggagctccggcaccctctgggctgccaggaccccacatca
gaacggtggtaccatgggcacctgtctggcaaggaggccgagaagctgctgacagagaag
gggcggcccggcagcttcctggttcgggagagtcagagcaaacctggggactttgtgctg
tcggtcctcacacagctgctggataaggcggactgccaaccacgggtcactcacatcagg
atccacttccagccggaggggaagtacgacgtgggaggtggggagcagttcgacaccctg
ggagatctggtggaacactacaggaagagccccatggtggagaggtcaggggccatggtg
cacctcgggcagcccctcaaggccacacgaatcaaggctgcaagcattgagagccgcgtg
caggagctcaacaaggtcatggatgccagcgagaaggccaagcagggcttctgggaggag
tttgagctgctgcagcagcaggaatgccagctcctgcatccccggagggaagggcagcgg
ctggagaacaagcccaagaatcgctacaagaacattcttccatttgataccacccgtgtc
gtgttgcgtgacgtggacaagaatgtgcctggggctgactacatcaatgccaactacatc
aggagtgacccagaagagaagccaggccatggactgggcaagttgtacattgccacccag
ggctgcctgcagaccacggtagctgccttctgggccatggtgcaccaggagaacacccgt
gtcattgtcatgaccaccagggaggtggagcgaggccggaacaagtgtttccgatactgg
ccagagctgcatggcagccaagggtatggccacctgcgtgtgcgcaacgtggctgagcac
tgggctcagggctattgtgtgcgggagctgcaggtgtggcagccaaaccaggaggagtcg
cagcgcgttgtgaagcactatcagtactgcagctggccggaccatggagtcccggccgag
cctgccggcgtcctgggcttcctggacgaggtgaaccgggcgcagaacagcatgccaggg
gccggacccgtggtggtgcactgcagcgcgggcatcggacgcactggcaccattattgtg
attgacatcctagtggacatcgttcgcaggcaggggctggactgcgatatcgacgtcccc
aagacgatccagctggtgcggcgacagcgctccgggatggtgcagacggaggcgcagtac
aagttcgtgtacctggcgctgcagcggtacatccagggacagcagctgcgcctgcgcgag
caggaggcggggccggtccggggcggagccagcgcgggcatcaccatggtgaccagcggt
ccctcccctcagcgcgagccgcctaaggagcacgactctctgaacgtgggcgccttgcca
gccgaccgcggctgtagcccgggacccgcgccgtccccggcacccgaggcgaccccagag
gcctccggtcgcgagtacgagaacctgctgggcctcaggccctga

DBGET integrated database retrieval system