KEGG   Sus scrofa (pig): 100192444
Entry
100192444         CDS       T01009                                 

Gene name
CRK
Definition
(RefSeq) adapter molecule crk
  KO
K04438  C-crk adapter molecule crk
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04010  MAPK signaling pathway
ssc04012  ErbB signaling pathway
ssc04015  Rap1 signaling pathway
ssc04062  Chemokine signaling pathway
ssc04510  Focal adhesion
ssc04666  Fc gamma R-mediated phagocytosis
ssc04722  Neurotrophin signaling pathway
ssc04810  Regulation of actin cytoskeleton
ssc04910  Insulin signaling pathway
ssc04935  Growth hormone synthesis, secretion and action
ssc05100  Bacterial invasion of epithelial cells
ssc05135  Yersinia infection
ssc05163  Human cytomegalovirus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05200  Pathways in cancer
ssc05206  MicroRNAs in cancer
ssc05211  Renal cell carcinoma
ssc05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100192444 (CRK)
   04012 ErbB signaling pathway
    100192444 (CRK)
   04015 Rap1 signaling pathway
    100192444 (CRK)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100192444 (CRK)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100192444 (CRK)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100192444 (CRK)
   04062 Chemokine signaling pathway
    100192444 (CRK)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100192444 (CRK)
   04935 Growth hormone synthesis, secretion and action
    100192444 (CRK)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100192444 (CRK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100192444 (CRK)
   05206 MicroRNAs in cancer
    100192444 (CRK)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100192444 (CRK)
   05211 Renal cell carcinoma
    100192444 (CRK)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100192444 (CRK)
   05100 Bacterial invasion of epithelial cells
    100192444 (CRK)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100192444 (CRK)
   05163 Human cytomegalovirus infection
    100192444 (CRK)
Domain-containing proteins not elsewhere classified [BR:ssc04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   100192444 (CRK)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 SH3_10 DUF3804
Other DBs
NCBI-GeneID: 100192444
NCBI-ProteinID: NP_001131108
UniProt: B6DX82
LinkDB
Position
12
AA seq 304 aa
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHY
IINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSR
SRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG
MIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPIVNTPLPNLQNGPIYA
RVIQKRVPNAYDKTALALEVGELVKVTKINMSGQWEGECNGKRGHFPFTHVCLLDQQNPD
EDFS
NT seq 915 nt   +upstreamnt  +downstreamnt
atggcgggcaacttcgactcggaggagcggagtagctggtactgggggcggctgagccgg
caggaggcggtggcgctgttgcagggccagcggcacggggtgttcctggtgcgggactcg
agcaccagccccggggactatgtgctcagcgtctccgagaactcgcgcgtctcccactac
atcatcaacagcagcggcccgcgcccgccagtgccaccgtcgcccgcccagcctccgccc
ggggtgagcccctccagactccgaataggagatcaagaatttgattcattgcctgcttta
ctggaattctacaaaatacactatttggacactacaacgttgatagaaccagtttccaga
tccaggcagggtagtggagtgattctcaggcaggaagaggcagagtatgtccgagccctc
tttgactttaatgggaatgatgaggaagatcttccctttaagaaaggagacatcctgaga
atccgggataagcctgaagagcagtggtggaatgcggaggacagcgaaggcaagaggggg
atgatcccagtcccttacgtcgagaagtatagacctgcctccgcctcagtatcggctctg
attggaggtaaccaggagggttcccacccacagccattgggtgggccggagcccgggccc
tatgcccaacccatcgtcaacactccgctccctaacctccagaatgggcccatttatgcc
agggtaatccagaagcgagtccctaatgcctacgacaagacagccttggctttggaggtc
ggtgagctggtaaaggttacgaagattaatatgagtggtcagtgggaaggggagtgtaat
ggcaaacgaggtcacttcccattcacacatgtctgtctgctggatcaacagaatcccgat
gaggacttcagctga

KEGG   Sus scrofa (pig): 100525363
Entry
100525363         CDS       T01009                                 

Gene name
CRKL
Definition
(RefSeq) crk-like protein
  KO
K04438  C-crk adapter molecule crk
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04010  MAPK signaling pathway
ssc04012  ErbB signaling pathway
ssc04015  Rap1 signaling pathway
ssc04062  Chemokine signaling pathway
ssc04510  Focal adhesion
ssc04666  Fc gamma R-mediated phagocytosis
ssc04722  Neurotrophin signaling pathway
ssc04810  Regulation of actin cytoskeleton
ssc04910  Insulin signaling pathway
ssc04935  Growth hormone synthesis, secretion and action
ssc05100  Bacterial invasion of epithelial cells
ssc05135  Yersinia infection
ssc05163  Human cytomegalovirus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05200  Pathways in cancer
ssc05206  MicroRNAs in cancer
ssc05211  Renal cell carcinoma
ssc05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100525363 (CRKL)
   04012 ErbB signaling pathway
    100525363 (CRKL)
   04015 Rap1 signaling pathway
    100525363 (CRKL)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100525363 (CRKL)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100525363 (CRKL)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100525363 (CRKL)
   04062 Chemokine signaling pathway
    100525363 (CRKL)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100525363 (CRKL)
   04935 Growth hormone synthesis, secretion and action
    100525363 (CRKL)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100525363 (CRKL)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100525363 (CRKL)
   05206 MicroRNAs in cancer
    100525363 (CRKL)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100525363 (CRKL)
   05211 Renal cell carcinoma
    100525363 (CRKL)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100525363 (CRKL)
   05100 Bacterial invasion of epithelial cells
    100525363 (CRKL)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100525363 (CRKL)
   05163 Human cytomegalovirus infection
    100525363 (CRKL)
Domain-containing proteins not elsewhere classified [BR:ssc04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   100525363 (CRKL)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 hSH3
Other DBs
NCBI-GeneID: 100525363
NCBI-ProteinID: XP_003133042
Ensembl: ENSSSCG00000010095
UniProt: F1RKX9 A0A4X1UYQ0
LinkDB
Position
14
AA seq 303 aa
MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSH
YIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPVGSVSAPNLPT
AEENLEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKEGRVGMIPVPYVEK
LVRSSPLGKHGNRNSNSYGIPEPAHAYAQPQTTAPLPAVPSTPGVTVNPLPSTQNGPVFA
KAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIIDPQNPD
ENE
NT seq 912 nt   +upstreamnt  +downstreamnt
atgtcctccgccaggttcgactcctcagaccgctcggcctggtatatggggcccgtgtct
cgccaggaggcgcagacccggctccagggccagcgccacggaatgtttctggtccgcgat
tcgtccacctgccccggcgactacgtgctgtcggtatccgagaactcgcgggtgtcccac
tacatcatcaactcgctgcccaaccgccgcttcaagatcggggaccaggagttcgaccac
ctgccggccctgctggagttctacaagatccactacctggacaccaccaccctcatcgag
ccagcgcccaggtatccaagcccaccagtgggctctgtgtccgcacccaacctgcccaca
gcggaagaaaatctggaatatgtacggactctctatgattttcctgggaatgatgccgaa
gacctgccctttaaaaagggtgagatcttggtgataatagagaagccagaagaacagtgg
tggagtgcccggaacaaggagggccgggtcgggatgatccctgtcccttacgtggagaag
ctcgtgaggtcctcaccacttggaaagcatgggaataggaattccaacagttacggaatc
ccagaacctgctcacgcgtacgctcagcctcagaccacagctcctctgcctgccgttccc
agtactcctggggtgacggtcaaccctctgccatccacgcagaatggacctgtctttgca
aaagcaatccagaaaagagtgccctgtgcgtatgacaagaccgccttggcattagaggtc
ggtgacattgtcaaagtcacacggatgaacataaacggccagtgggaaggtgaggtgaat
gggcgcaaagggctcttccccttcacacacgtcaaaatcatcgacccccagaaccctgat
gagaatgagtga

DBGET integrated database retrieval system