KEGG   Sus scrofa (pig): 100192445
Entry
100192445         CDS       T01009                                 

Gene name
PDPK1
Definition
(RefSeq) 3-phosphoinositide-dependent protein kinase 1
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01524  Platinum drug resistance
ssc03320  PPAR signaling pathway
ssc04068  FoxO signaling pathway
ssc04071  Sphingolipid signaling pathway
ssc04140  Autophagy - animal
ssc04150  mTOR signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04152  AMPK signaling pathway
ssc04210  Apoptosis
ssc04510  Focal adhesion
ssc04660  T cell receptor signaling pathway
ssc04664  Fc epsilon RI signaling pathway
ssc04722  Neurotrophin signaling pathway
ssc04910  Insulin signaling pathway
ssc04919  Thyroid hormone signaling pathway
ssc04931  Insulin resistance
ssc04960  Aldosterone-regulated sodium reabsorption
ssc05145  Toxoplasmosis
ssc05205  Proteoglycans in cancer
ssc05213  Endometrial cancer
ssc05215  Prostate cancer
ssc05223  Non-small cell lung cancer
ssc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100192445 (PDPK1)
   04071 Sphingolipid signaling pathway
    100192445 (PDPK1)
   04151 PI3K-Akt signaling pathway
    100192445 (PDPK1)
   04152 AMPK signaling pathway
    100192445 (PDPK1)
   04150 mTOR signaling pathway
    100192445 (PDPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100192445 (PDPK1)
  09143 Cell growth and death
   04210 Apoptosis
    100192445 (PDPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100192445 (PDPK1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100192445 (PDPK1)
   04664 Fc epsilon RI signaling pathway
    100192445 (PDPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100192445 (PDPK1)
   03320 PPAR signaling pathway
    100192445 (PDPK1)
   04919 Thyroid hormone signaling pathway
    100192445 (PDPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100192445 (PDPK1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100192445 (PDPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100192445 (PDPK1)
   05231 Choline metabolism in cancer
    100192445 (PDPK1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100192445 (PDPK1)
   05213 Endometrial cancer
    100192445 (PDPK1)
   05223 Non-small cell lung cancer
    100192445 (PDPK1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100192445 (PDPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100192445 (PDPK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100192445 (PDPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100192445 (PDPK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssc04131]
    100192445 (PDPK1)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100192445 (PDPK1)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   100192445 (PDPK1)
Membrane trafficking [BR:ssc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    100192445 (PDPK1)
SSDB
Motif
Pfam: Pkinase PH_3 PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH Kdo YukC
Other DBs
NCBI-GeneID: 100192445
NCBI-ProteinID: XP_020942410
LinkDB
Position
3
AA seq 558 aa
MARTTSQLYDAAPVQSSVVLCSCPSPSMVRTQTESSAAPGVPSGGSRQGPTMDSTAAEAR
PNTRSLQHAAQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHI
IKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFD
ETCTRFYTAEMVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQAR
ANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLE
YDFPEKFFPKARDLVEKLLVLDATKRLGCEEMGGYSPLKAHAFFESVMWENLHHQTPPKL
TAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSPSSQSLSAVDAGLPQRAGSNIEQYIHD
LDTNSFELDLQFSEDEKRLLLEKQASGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLL
TEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCKK
IQEVWRHRYQSHPDAAVQ
NT seq 1677 nt   +upstreamnt  +downstreamnt
atggccaggaccactagccagctgtatgacgccgctccggttcagtccagcgtggtgttg
tgttcctgcccgtccccatcaatggtgaggacccagacggagtccagcgcggcccctggc
gttcccagcggtggtagcaggcagggtcccaccatggacagcaccgcggccgaagcccgg
ccaaacacacgctcgctgcagcacgccgcacagccgccgccgcagcctcggaagaaacgg
ccggaagactttaaatttgggaagatccttggcgaaggctctttttcaacagttgttctg
gcccgagaactggcaacctcaagggaatatgctattaaaattctagagaaacgtcacatt
atcaaagagaacaaagtcccatatgtcacccgagaaagagacgtgatgtcacgcctggat
caccccttctttgttaaactttacttcacatttcaggacgacgaaaagctttattttggc
cttagttatgccaaaaatggagaactgcttaaatacattcgcaaaatcggttcgtttgat
gagacctgcacccgattttacacggcggagatggtgtctgccctggagtacttgcatggc
aagggcatcatccacagggacctgaaaccagaaaacatcttgctaaatgaagacatgcac
atccagatcacagattttggaacagccaaagtcttgtccccagagagtaagcaagccagg
gccaactcgtttgtaggaacagcccagtatgtttctccagagctgctcacagagaagtcg
gcctgtaaaagttcagacctttgggctcttggatgcataatataccagcttgtggcagga
ctgcccccgttccgagctggaaatgaatatcttatatttcagaagatcattaagttggaa
tatgactttcctgaaaaattctttcctaaagcaagagatcttgtggaaaaacttctggtc
ctagatgccaccaagcgattaggctgtgaagaaatgggagggtacagccctctgaaggct
cacgcgttcttcgagtcggtcatgtgggagaacctgcatcatcagacgcccccgaagctc
acggcctacctcccggccatgtcggaggacgacgaggactgctacggcaactacgacaac
ctcctgagccagttcggctgcatgcaggtgtcttcgtcgccctcttcccagtccctgtct
gccgtggacgcgggcctgccccagagggcgggcagcaacatcgagcagtatatccacgac
ctggacactaattcttttgaactggatttacagttttctgaggatgagaagaggttgttg
ctggagaagcaggccagcggaaacccttggcaccagtttgtagaaaataatttaatactg
aaaatgggtccagtagacaagcgaaagggtttgtttgcgcggcgacgacagttactgctc
acggaagggccacacttatattacgtggatcctgtcaacaaagtcttgaaaggtgaaatt
ccgtggtcacaagaactccgaccagaggccaagaattttaaaaccttctttgtccacacg
ccgaataggacgtattacctgatggacccgagcgggaatgctcacaaatggtgcaaaaag
atccaggaggtgtggaggcacagataccagagccacccagatgccgctgtgcagtga

DBGET integrated database retrieval system