KEGG   Sus scrofa (pig): 100233191
Entry
100233191         CDS       T01009                                 

Gene name
MAP2K1
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc01522  Endocrine resistance
ssc04010  MAPK signaling pathway
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04015  Rap1 signaling pathway
ssc04022  cGMP-PKG signaling pathway
ssc04024  cAMP signaling pathway
ssc04062  Chemokine signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04068  FoxO signaling pathway
ssc04071  Sphingolipid signaling pathway
ssc04072  Phospholipase D signaling pathway
ssc04114  Oocyte meiosis
ssc04140  Autophagy - animal
ssc04150  mTOR signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04210  Apoptosis
ssc04218  Cellular senescence
ssc04270  Vascular smooth muscle contraction
ssc04370  VEGF signaling pathway
ssc04371  Apelin signaling pathway
ssc04380  Osteoclast differentiation
ssc04510  Focal adhesion
ssc04540  Gap junction
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04613  Neutrophil extracellular trap formation
ssc04620  Toll-like receptor signaling pathway
ssc04650  Natural killer cell mediated cytotoxicity
ssc04660  T cell receptor signaling pathway
ssc04662  B cell receptor signaling pathway
ssc04664  Fc epsilon RI signaling pathway
ssc04666  Fc gamma R-mediated phagocytosis
ssc04668  TNF signaling pathway
ssc04720  Long-term potentiation
ssc04722  Neurotrophin signaling pathway
ssc04725  Cholinergic synapse
ssc04726  Serotonergic synapse
ssc04730  Long-term depression
ssc04810  Regulation of actin cytoskeleton
ssc04910  Insulin signaling pathway
ssc04912  GnRH signaling pathway
ssc04914  Progesterone-mediated oocyte maturation
ssc04915  Estrogen signaling pathway
ssc04916  Melanogenesis
ssc04917  Prolactin signaling pathway
ssc04919  Thyroid hormone signaling pathway
ssc04921  Oxytocin signaling pathway
ssc04926  Relaxin signaling pathway
ssc04928  Parathyroid hormone synthesis, secretion and action
ssc04929  GnRH secretion
ssc04934  Cushing syndrome
ssc04935  Growth hormone synthesis, secretion and action
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05034  Alcoholism
ssc05132  Salmonella infection
ssc05135  Yersinia infection
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05163  Human cytomegalovirus infection
ssc05164  Influenza A
ssc05165  Human papillomavirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05206  MicroRNAs in cancer
ssc05210  Colorectal cancer
ssc05211  Renal cell carcinoma
ssc05212  Pancreatic cancer
ssc05213  Endometrial cancer
ssc05214  Glioma
ssc05215  Prostate cancer
ssc05216  Thyroid cancer
ssc05218  Melanoma
ssc05219  Bladder cancer
ssc05220  Chronic myeloid leukemia
ssc05221  Acute myeloid leukemia
ssc05223  Non-small cell lung cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
ssc05230  Central carbon metabolism in cancer
ssc05231  Choline metabolism in cancer
ssc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100233191 (MAP2K1)
   04012 ErbB signaling pathway
    100233191 (MAP2K1)
   04014 Ras signaling pathway
    100233191 (MAP2K1)
   04015 Rap1 signaling pathway
    100233191 (MAP2K1)
   04370 VEGF signaling pathway
    100233191 (MAP2K1)
   04371 Apelin signaling pathway
    100233191 (MAP2K1)
   04668 TNF signaling pathway
    100233191 (MAP2K1)
   04066 HIF-1 signaling pathway
    100233191 (MAP2K1)
   04068 FoxO signaling pathway
    100233191 (MAP2K1)
   04072 Phospholipase D signaling pathway
    100233191 (MAP2K1)
   04071 Sphingolipid signaling pathway
    100233191 (MAP2K1)
   04024 cAMP signaling pathway
    100233191 (MAP2K1)
   04022 cGMP-PKG signaling pathway
    100233191 (MAP2K1)
   04151 PI3K-Akt signaling pathway
    100233191 (MAP2K1)
   04150 mTOR signaling pathway
    100233191 (MAP2K1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100233191 (MAP2K1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100233191 (MAP2K1)
   04210 Apoptosis
    100233191 (MAP2K1)
   04218 Cellular senescence
    100233191 (MAP2K1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100233191 (MAP2K1)
   04540 Gap junction
    100233191 (MAP2K1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100233191 (MAP2K1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100233191 (MAP2K1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100233191 (MAP2K1)
   04620 Toll-like receptor signaling pathway
    100233191 (MAP2K1)
   04650 Natural killer cell mediated cytotoxicity
    100233191 (MAP2K1)
   04660 T cell receptor signaling pathway
    100233191 (MAP2K1)
   04662 B cell receptor signaling pathway
    100233191 (MAP2K1)
   04664 Fc epsilon RI signaling pathway
    100233191 (MAP2K1)
   04666 Fc gamma R-mediated phagocytosis
    100233191 (MAP2K1)
   04062 Chemokine signaling pathway
    100233191 (MAP2K1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100233191 (MAP2K1)
   04929 GnRH secretion
    100233191 (MAP2K1)
   04912 GnRH signaling pathway
    100233191 (MAP2K1)
   04915 Estrogen signaling pathway
    100233191 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    100233191 (MAP2K1)
   04917 Prolactin signaling pathway
    100233191 (MAP2K1)
   04921 Oxytocin signaling pathway
    100233191 (MAP2K1)
   04926 Relaxin signaling pathway
    100233191 (MAP2K1)
   04935 Growth hormone synthesis, secretion and action
    100233191 (MAP2K1)
   04919 Thyroid hormone signaling pathway
    100233191 (MAP2K1)
   04928 Parathyroid hormone synthesis, secretion and action
    100233191 (MAP2K1)
   04916 Melanogenesis
    100233191 (MAP2K1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100233191 (MAP2K1)
  09156 Nervous system
   04725 Cholinergic synapse
    100233191 (MAP2K1)
   04726 Serotonergic synapse
    100233191 (MAP2K1)
   04720 Long-term potentiation
    100233191 (MAP2K1)
   04730 Long-term depression
    100233191 (MAP2K1)
   04722 Neurotrophin signaling pathway
    100233191 (MAP2K1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100233191 (MAP2K1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100233191 (MAP2K1)
   05206 MicroRNAs in cancer
    100233191 (MAP2K1)
   05205 Proteoglycans in cancer
    100233191 (MAP2K1)
   05230 Central carbon metabolism in cancer
    100233191 (MAP2K1)
   05231 Choline metabolism in cancer
    100233191 (MAP2K1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100233191 (MAP2K1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100233191 (MAP2K1)
   05212 Pancreatic cancer
    100233191 (MAP2K1)
   05225 Hepatocellular carcinoma
    100233191 (MAP2K1)
   05226 Gastric cancer
    100233191 (MAP2K1)
   05214 Glioma
    100233191 (MAP2K1)
   05216 Thyroid cancer
    100233191 (MAP2K1)
   05221 Acute myeloid leukemia
    100233191 (MAP2K1)
   05220 Chronic myeloid leukemia
    100233191 (MAP2K1)
   05218 Melanoma
    100233191 (MAP2K1)
   05211 Renal cell carcinoma
    100233191 (MAP2K1)
   05219 Bladder cancer
    100233191 (MAP2K1)
   05215 Prostate cancer
    100233191 (MAP2K1)
   05213 Endometrial cancer
    100233191 (MAP2K1)
   05224 Breast cancer
    100233191 (MAP2K1)
   05223 Non-small cell lung cancer
    100233191 (MAP2K1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100233191 (MAP2K1)
   05022 Pathways of neurodegeneration - multiple diseases
    100233191 (MAP2K1)
  09165 Substance dependence
   05034 Alcoholism
    100233191 (MAP2K1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100233191 (MAP2K1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100233191 (MAP2K1)
   05135 Yersinia infection
    100233191 (MAP2K1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100233191 (MAP2K1)
   05170 Human immunodeficiency virus 1 infection
    100233191 (MAP2K1)
   05161 Hepatitis B
    100233191 (MAP2K1)
   05160 Hepatitis C
    100233191 (MAP2K1)
   05164 Influenza A
    100233191 (MAP2K1)
   05163 Human cytomegalovirus infection
    100233191 (MAP2K1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100233191 (MAP2K1)
   05165 Human papillomavirus infection
    100233191 (MAP2K1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100233191 (MAP2K1)
   01522 Endocrine resistance
    100233191 (MAP2K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100233191 (MAP2K1)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100233191 (MAP2K1)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: STE group
  STE7 family
   100233191 (MAP2K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7 Kdo NAD_binding_6
Other DBs
NCBI-GeneID: 100233191
NCBI-ProteinID: NP_001137188
UniProt: B8XSJ8
LinkDB
Position
1
AA seq 393 aa
MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRGLAYL
REKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSY
GMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAF
IKRSDAEEVDFAGWLCSTIGLNQPSTPTHAAGV
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgcccaagaagaagccgacgcccatccagctgaacccggcccccgacggctccgcggtt
aacgggaccagctcggcggagaccaacctggaggccttgcagaagaagctggaggagctg
gagctcgatgaacagcagcggaagcgcctcgaggcctttcttacccagaagcagaaggtg
ggggaactgaaggatgacgacttcgagaagatcagtgagctgggtgccggcaatggaggt
gtggtgttcaaggtctcccacaagccgtccggcctggtcatggcccgaaagctaattcac
ctggagatcaaacctgcaatccggaatcagattataagggagctgcaggttctacatgag
tgcaattccccctacattgtgggcttctacggcgcattctacagcgatggcgagatcagt
atctgcatggagcacatggatggcggctccctggaccaggtgttgaaagaagccaagaga
attcctgaggaaatcctggggaaggtcagcatcgcggttctgcggggcctggcatatctc
cgggaaaagcaccagatcatgcaccgagatgtgaagccatccaacatccttgtcaactcc
cgaggggagatcaagttgtgcgactttggggtgagcgggcagctcatcgattccatggcc
aactccttcgtgggaacacggtcctacatgtctccggagcggctgcagggcactcactac
tcggtgcagtcggacatctggagcatggggctctctctggttgagatggcggtcgggagg
tatcccatccctcctccagatgccaaggagctggagctgatgtttggatgccaggtggag
ggagatgcagctgagacaccacccaggccaaggaccccggggaggcccctcagctcttat
ggaatggacagccgacctcccatggcaatttttgagttgctggattacatagtcaatgag
cctcctcccaaactacccagtggagtattcagcctggaatttcaagattttgtgaataaa
tgcttaataaaaaaccctgcagagagagccgatttgaagcaactcatggttcatgctttc
atcaaaagatctgatgctgaggaagtagattttgcaggttggctctgctccaccatcggc
cttaaccagcccagcacacccacccatgcggctggtgtctaa

KEGG   Sus scrofa (pig): 100525505
Entry
100525505         CDS       T01009                                 

Gene name
MAP2K2
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc01522  Endocrine resistance
ssc04010  MAPK signaling pathway
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04015  Rap1 signaling pathway
ssc04022  cGMP-PKG signaling pathway
ssc04024  cAMP signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04068  FoxO signaling pathway
ssc04071  Sphingolipid signaling pathway
ssc04072  Phospholipase D signaling pathway
ssc04140  Autophagy - animal
ssc04150  mTOR signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04210  Apoptosis
ssc04218  Cellular senescence
ssc04270  Vascular smooth muscle contraction
ssc04370  VEGF signaling pathway
ssc04371  Apelin signaling pathway
ssc04540  Gap junction
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04613  Neutrophil extracellular trap formation
ssc04620  Toll-like receptor signaling pathway
ssc04650  Natural killer cell mediated cytotoxicity
ssc04660  T cell receptor signaling pathway
ssc04662  B cell receptor signaling pathway
ssc04664  Fc epsilon RI signaling pathway
ssc04720  Long-term potentiation
ssc04722  Neurotrophin signaling pathway
ssc04730  Long-term depression
ssc04810  Regulation of actin cytoskeleton
ssc04910  Insulin signaling pathway
ssc04912  GnRH signaling pathway
ssc04915  Estrogen signaling pathway
ssc04916  Melanogenesis
ssc04917  Prolactin signaling pathway
ssc04919  Thyroid hormone signaling pathway
ssc04921  Oxytocin signaling pathway
ssc04926  Relaxin signaling pathway
ssc04929  GnRH secretion
ssc04934  Cushing syndrome
ssc04935  Growth hormone synthesis, secretion and action
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05132  Salmonella infection
ssc05135  Yersinia infection
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05163  Human cytomegalovirus infection
ssc05164  Influenza A
ssc05165  Human papillomavirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05206  MicroRNAs in cancer
ssc05210  Colorectal cancer
ssc05211  Renal cell carcinoma
ssc05213  Endometrial cancer
ssc05214  Glioma
ssc05215  Prostate cancer
ssc05216  Thyroid cancer
ssc05218  Melanoma
ssc05219  Bladder cancer
ssc05220  Chronic myeloid leukemia
ssc05221  Acute myeloid leukemia
ssc05223  Non-small cell lung cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
ssc05230  Central carbon metabolism in cancer
ssc05231  Choline metabolism in cancer
ssc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100525505 (MAP2K2)
   04012 ErbB signaling pathway
    100525505 (MAP2K2)
   04014 Ras signaling pathway
    100525505 (MAP2K2)
   04015 Rap1 signaling pathway
    100525505 (MAP2K2)
   04370 VEGF signaling pathway
    100525505 (MAP2K2)
   04371 Apelin signaling pathway
    100525505 (MAP2K2)
   04066 HIF-1 signaling pathway
    100525505 (MAP2K2)
   04068 FoxO signaling pathway
    100525505 (MAP2K2)
   04072 Phospholipase D signaling pathway
    100525505 (MAP2K2)
   04071 Sphingolipid signaling pathway
    100525505 (MAP2K2)
   04024 cAMP signaling pathway
    100525505 (MAP2K2)
   04022 cGMP-PKG signaling pathway
    100525505 (MAP2K2)
   04151 PI3K-Akt signaling pathway
    100525505 (MAP2K2)
   04150 mTOR signaling pathway
    100525505 (MAP2K2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100525505 (MAP2K2)
  09143 Cell growth and death
   04210 Apoptosis
    100525505 (MAP2K2)
   04218 Cellular senescence
    100525505 (MAP2K2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100525505 (MAP2K2)
   04550 Signaling pathways regulating pluripotency of stem cells
    100525505 (MAP2K2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100525505 (MAP2K2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100525505 (MAP2K2)
   04620 Toll-like receptor signaling pathway
    100525505 (MAP2K2)
   04650 Natural killer cell mediated cytotoxicity
    100525505 (MAP2K2)
   04660 T cell receptor signaling pathway
    100525505 (MAP2K2)
   04662 B cell receptor signaling pathway
    100525505 (MAP2K2)
   04664 Fc epsilon RI signaling pathway
    100525505 (MAP2K2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100525505 (MAP2K2)
   04929 GnRH secretion
    100525505 (MAP2K2)
   04912 GnRH signaling pathway
    100525505 (MAP2K2)
   04915 Estrogen signaling pathway
    100525505 (MAP2K2)
   04917 Prolactin signaling pathway
    100525505 (MAP2K2)
   04921 Oxytocin signaling pathway
    100525505 (MAP2K2)
   04926 Relaxin signaling pathway
    100525505 (MAP2K2)
   04935 Growth hormone synthesis, secretion and action
    100525505 (MAP2K2)
   04919 Thyroid hormone signaling pathway
    100525505 (MAP2K2)
   04916 Melanogenesis
    100525505 (MAP2K2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100525505 (MAP2K2)
  09156 Nervous system
   04720 Long-term potentiation
    100525505 (MAP2K2)
   04730 Long-term depression
    100525505 (MAP2K2)
   04722 Neurotrophin signaling pathway
    100525505 (MAP2K2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100525505 (MAP2K2)
   05206 MicroRNAs in cancer
    100525505 (MAP2K2)
   05205 Proteoglycans in cancer
    100525505 (MAP2K2)
   05230 Central carbon metabolism in cancer
    100525505 (MAP2K2)
   05231 Choline metabolism in cancer
    100525505 (MAP2K2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100525505 (MAP2K2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100525505 (MAP2K2)
   05225 Hepatocellular carcinoma
    100525505 (MAP2K2)
   05226 Gastric cancer
    100525505 (MAP2K2)
   05214 Glioma
    100525505 (MAP2K2)
   05216 Thyroid cancer
    100525505 (MAP2K2)
   05221 Acute myeloid leukemia
    100525505 (MAP2K2)
   05220 Chronic myeloid leukemia
    100525505 (MAP2K2)
   05218 Melanoma
    100525505 (MAP2K2)
   05211 Renal cell carcinoma
    100525505 (MAP2K2)
   05219 Bladder cancer
    100525505 (MAP2K2)
   05215 Prostate cancer
    100525505 (MAP2K2)
   05213 Endometrial cancer
    100525505 (MAP2K2)
   05224 Breast cancer
    100525505 (MAP2K2)
   05223 Non-small cell lung cancer
    100525505 (MAP2K2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100525505 (MAP2K2)
   05022 Pathways of neurodegeneration - multiple diseases
    100525505 (MAP2K2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100525505 (MAP2K2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100525505 (MAP2K2)
   05135 Yersinia infection
    100525505 (MAP2K2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100525505 (MAP2K2)
   05170 Human immunodeficiency virus 1 infection
    100525505 (MAP2K2)
   05161 Hepatitis B
    100525505 (MAP2K2)
   05160 Hepatitis C
    100525505 (MAP2K2)
   05164 Influenza A
    100525505 (MAP2K2)
   05163 Human cytomegalovirus infection
    100525505 (MAP2K2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100525505 (MAP2K2)
   05165 Human papillomavirus infection
    100525505 (MAP2K2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100525505 (MAP2K2)
   01522 Endocrine resistance
    100525505 (MAP2K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100525505 (MAP2K2)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100525505 (MAP2K2)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: STE group
  STE7 family
   100525505 (MAP2K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7 Kdo CAMSAP_CC1
Other DBs
NCBI-GeneID: 100525505
NCBI-ProteinID: NP_001231479
Ensembl: ENSSSCG00000013500 ENSSSCG00000027127
Vega: OTTSUSG00000003504
UniProt: K7GPS0 A0A4X1VTZ6
LinkDB
Position
2
AA seq 400 aa
MLARRKPVLPALTINPAIAEGPSPTSEGASEANLVDLQKKLEELELDEQQKKRLEAFLTQ
KAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQ
VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRG
LAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQ
GTHYSVQSDIWSMGLSLVELSIGRYPIPPPDAKELEAIFGRPMVDGGDGEPHSISPRPRP
PGRPISGHGMDSRPAMAIFELLDYIVNEPPPKLPNGVFTQDFQEFVNKCLIKNPAERADL
KMLMNHTFIKRSEVEEVDFAGWLCKTLRLNQPSTPTRTAV
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgctggcccggaggaagccggtgctgccggcgctcaccatcaaccccgccatcgccgag
ggcccgtcccccaccagcgagggcgcctccgaagcaaacttggtggatctccagaagaag
ctagaggagctagaactcgacgagcagcagaagaagcggctagaagcctttctcacccag
aaggccaaggtcggggagctcaaggacgatgactttgaaaggatctcggagctgggagcc
gggaacggcggagtggtcaccaaggtccagcacagaccctcaggcctcatcatggcaaga
aagctgatccacttggagatcaagccggccatccggaaccagatcatccgcgagctgcag
gtactgcacgagtgtaactccccctacatcgtgggcttctatggggccttctacagtgac
ggggagatcagtatctgcatggagcacatggatggcggctccctggaccaggtgttgaaa
gaagccaagagaattcctgaggaaatcctggggaaggtcagcatcgcggttctgcggggc
ctggcatatctccgggaaaagcaccagatcatgcaccgagatgtgaagccatccaacatc
cttgtcaactcccgaggggagatcaagttgtgcgactttggggtgagcgggcagctcatc
gattccatggccaactccttcgtgggaacacggtcctacatgtctccggagcggctgcag
ggcactcactactcggtgcagtcggacatctggagcatgggcctgtccctggtggagctg
tccatcggaaggtaccccatccccccaccggatgccaaggagctggaggccatatttggc
cggcccatggttgatggaggggacggagagcctcacagcatctcgccacggccgagaccc
cctggacgccccatcagcggtcacgggatggacagccggccggccatggctatcttcgag
ctgctggactacatcgtgaatgagccacctcccaagctgcccaatggcgtcttcacccag
gacttccaggagtttgtaaataaatgcctaattaagaacccagcagagcgagcggatctg
aagatgctcatgaaccacaccttcatcaaacggtccgaggtggaagaagtggattttgcc
ggctggttgtgtaaaacgctgcggctgaaccagcccagcacgcccacgcgcaccgccgtg
tga

DBGET integrated database retrieval system