KEGG   Sus scrofa (pig): 100302368Help
Entry
100302368         CDS       T01009                                 

Definition
(RefSeq) trypsinogen precursor
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04080  Neuroactive ligand-receptor interaction
ssc04972  Pancreatic secretion
ssc04974  Protein digestion and absorption
ssc05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100302368
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    100302368
   04974 Protein digestion and absorption
    100302368
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    100302368
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ssc01002]
    100302368
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssc04147]
    100302368
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     100302368
Peptidases [BR:ssc01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100302368
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100302368
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 100302368
NCBI-ProteinID: NP_001156363
Ensembl: ENSSSCG00000016483
UniProt: C5IWV5
LinkDB All DBs
Structure
PDB: 

Position
18
AA seq 246 aa AA seqDB search
MNTFVLLALLGAAVAFPTDDDDKIVGGYTCAANSVPYQVSLNSGSHFCGGSLINSQWVVS
AAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLN
SRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQIT
GNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQ
QTIAAN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaacacctttgtcttgcttgcgctcctgggagctgctgttgctttccccacggatgat
gatgacaagatcgtcgggggttacacctgtgcagcaaattccgttccctaccaggtgtcc
ctgaattctggctcccacttctgtggtgggtccctcatcaacagccagtgggtggtgtct
gctgctcactgctacaagtcccgaatccaggtgcgtctgggagaacacaacatcgacgtc
cttgagggcaatgagcaattcatcaatgccgccaagatcatcacccaccccaatttcaat
ggaaataccttagataacgacatcatgctgattaaactgagctcacctgccactctcaac
agtcgagtagcaactgtctcactgccaaggtcttgtgcagctgctggtaccgagtgtctc
atctctggctggggcaacaccaaaagcagtggctccagctacccttcgctcctgcaatgc
ctgaaggctcccgtcctaagtgacagttcttgcaagagttcctatccaggccagatcacc
ggaaacatgatctgtgtgggcttcctggagggtggaaaggattcttgccagggtgactct
ggtggtcccgtggtctgcaatggacagctccagggtattgtctcttggggctatggctgc
gcccagaaaaacaagccaggggtctacaccaaggtatgcaactatgtgaactggattcag
cagaccatcgctgccaactaa

DBGET integrated database retrieval system