KEGG   Sus scrofa (pig): 100337665
Entry
100337665         CDS       T01009                                 

Gene name
MLH1
Definition
(RefSeq) DNA mismatch repair protein Mlh1
  KO
K08734  DNA mismatch repair protein MLH1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01524  Platinum drug resistance
ssc03430  Mismatch repair
ssc03460  Fanconi anemia pathway
ssc05200  Pathways in cancer
ssc05210  Colorectal cancer
ssc05213  Endometrial cancer
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    100337665 (MLH1)
   03460 Fanconi anemia pathway
    100337665 (MLH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100337665 (MLH1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100337665 (MLH1)
   05226 Gastric cancer
    100337665 (MLH1)
   05213 Endometrial cancer
    100337665 (MLH1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100337665 (MLH1)
DNA repair and recombination proteins [BR:ssc03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     100337665 (MLH1)
SSDB
Motif
Pfam: Mlh1_C DNA_mis_repair HATPase_c_3 HATPase_c
Other DBs
NCBI-GeneID: 100337665
NCBI-ProteinID: NP_001165838
Ensembl: ENSSSCG00000024222
UniProt: D3K5L8
LinkDB
Position
13
AA seq 757 aa
MSQVPGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVVVKEGGLKLIQ
IQDNGTGIRKEDLDIVCERFTTSKLQSFEDLAHISTYGFRGEALASISHVAHVAITTKTA
DGKCAYRAHYSDGKLKAPPKPCAGNQGTQITVEDLFYNISTRRKALKNPSEEYGKILEVV
GRYSIHNSGISFSVKKQGETVADVRTLPNATTVDNIRSIFGNAVSRELIEVECEDKTLAF
KMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISP
QNVDVNVHPTKHEVHFLHEDSILERVQQHIESRLLGSNASRTYFTQTLLPGLTGPSGEAV
KSAADVTPSSTGSGDKVYAYQMVRTDCREQKLDAFLQPASKSLSSQPQAIVPEDRTDAFG
SEARQQDEEMLELPAPSEVAAKHQSLEEDTAERTSDLSEKRGPPSSPGNPRKRHRESSDV
EMVEDANRKEMTAACIPRRRIINLTSVLTLQEEINERGHETLREMLHNHSFVGCVNPQWA
LAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTE
EDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLVGLPLLIDNYVPPLEGLPIFILR
LATEVNWDEEKECFESLSKECAMFYSIRKQYISEESTLSGQQSEAPGSTPNPWKWTVEHV
VYKAFRSYLLPPKCFTEDGNILQLANLPDLYKVFERC
NT seq 2274 nt   +upstreamnt  +downstreamnt
atgtcgcaggtaccgggagttatccggcggttggacgagacagtggtgaaccgcatcgcg
gcgggggaggttatccagcggccggctaatgccattaaggagatgattgagaactgttta
gatgcaaaatccacaagtattcaagtggtggttaaagagggaggcctgaagttgattcag
atccaagacaatggcactgggatcaggaaagaagatctggatattgtgtgtgagaggttc
accacaagtaaactgcagtcctttgaggatttagctcatatttctacctatggctttcgg
ggagaggctttggccagcataagccatgtggcacacgtcgccattacaaccaaaacagct
gatgggaagtgcgcatacagagcacattactcagatggaaagctgaaagctcctcctaaa
ccatgtgcaggcaatcaaggaacccagatcacggtggaggaccttttttacaacatatcc
acgagaaggaaggctttaaaaaatccaagtgaagagtatgggaaaattttggaagtcgtt
ggcaggtattcaatacacaattcaggcatcagtttctcggttaaaaaacaaggtgagaca
gtagccgacgttaggacactgcccaatgccacaaccgtggacaacattcgctccattttt
ggaaatgctgtcagccgagaactgatagaagttgaatgtgaggataaaaccctcgccttc
aaaatgaatgggtacatatccaatgcaaactactcggtgaagaagtgcatcttcttactc
ttcatcaaccatcgtctcgtagagtcaacctccttaagaaaagccatagaaacggtgtat
gcagcttatttgcctaaaaacacacatccgttcctgtacctcagtttagaaatcagcccc
cagaacgtggatgtcaacgtgcaccccacgaagcacgaggttcacttcctgcatgaggac
agcatcctggagcgtgtacagcagcacattgagagcaggctcctgggctccaatgcctct
aggacctacttcacccagactttactgccaggtcttactggcccctctggggaagcggtt
aaatctgcagcggatgtgacgccttcatctactggaagtggcgacaaggtctatgcctac
cagatggtccgcacagattgccgggaacagaagcttgatgccttcctgcagcctgcgagc
aagtccttatccagtcagccccaggccattgtccccgaggacagaacagatgcttttggt
agtgaggccaggcagcaggatgaggaaatgcttgaacttccagctccttctgaagtggct
gccaagcatcagagcttggaggaggatacagcagagaggacttcagacttgtcagagaag
agaggtcccccttccagccccgggaaccccagaaagagacatcgggaaagctctgatgtg
gaaatggtggaggatgcaaaccgaaaggaaatgacagcagcttgtatcccccggagaagg
atcattaacctcacaagtgttctgactctccaggaagaaatcaatgagcggggacatgag
actctccgggagatgctacataaccattcctttgtgggctgtgtgaatcctcagtgggcc
ttggcacagcatcagaccaagttataccttctgaacaccaccaaacttagtgaagagctg
ttctaccagattctcatttacgattttgccaattttggtgttctgaggttatcggagcca
gcaccgctctttgacctcgccatgctggctttggatagccccgagagcggctggacagag
gaagatggtcccaaagaaggacttgccgaatacattgttgagtttctgaaaaagaaagct
gagatgcttgcagactacttctccttggagattgatgaggaagggaacctggttggctta
cctcttctgatcgacaattacgtgcctcccttggagggtctgcctatcttcattctccgc
ctggccactgaggtgaactgggatgaagaaaaggaatgttttgaaagcctcagtaaagaa
tgtgctatgttttactctatccggaagcagtacatatctgaagagtcgaccctctcaggc
cagcagagcgaagcgcccggctccactcccaacccctggaagtggaccgtggagcatgtc
gtttataaagccttccgctcataccttctgcctcccaaatgtttcacagaagatggaaac
atcttgcagcttgccaacctgcccgacctatacaaagtcttcgagaggtgttaa

DBGET integrated database retrieval system