KEGG   Sus scrofa (pig): 100511769
Entry
100511769         CDS       T01009                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X1
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04010  MAPK signaling pathway
ssc04020  Calcium signaling pathway
ssc04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100511769 (CACNA1E)
   04020 Calcium signaling pathway
    100511769 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100511769 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ssc04040]
    100511769 (CACNA1E)
Ion channels [BR:ssc04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100511769 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 100511769
NCBI-ProteinID: XP_020958273
Ensembl: ENSSSCG00000015543
LinkDB
Position
9
AA seq 2451 aa
MVPEMRGLSPGRRLPEPILCPAAGGSPEPRAAGHRLRHVLALPEEEAWRPQQCALLEADA
SEEVGMLPASPRCAAAGFDNFFPVQEGEGPGWEGSSSPFLPVSPEVMKRRRGGLIEQRDI
IKAHEAHKMQSTPQARRKEWEMARFGEAVVGRPGSGDGDSDQSRNRQGTPVPASGPAAAY
KQSKAQRARTMALYNPIPVRQNCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATI
IANCIVLALEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNG
WNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMV
PLLQIGLLLFFAILMFAIIGLEFYSGKLHRACFTNHSGILEGFDPPHPCGVQGCPAGYEC
RDWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGS
FFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEEN
KNAGTSALEVLRRATIKRSRTEAMTRDSSDEHCVDISSVGTPLARASIKSAKVDGASYFR
HKERLLRISIRHMVKSQVFYWIVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLF
LLEMSLKMYGMGPRLYFHSSFNCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRI
FKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSAN
FDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFL
AIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMW
EPRSSHLRERRRRHHMSVWEQRTSQLRRHMQMSSQEALNKEEAPPMNPLNPLNPLSPLNP
LNAHPSLYRRPRPIEGLALGLGLEKCEEERISRGGSLKGDGGDLDHPRSPLSLGKREPPW
LARPCHGNCDPTQQEAGGGETVVTFEDRARHRQSQRRSRHRRVRTEGREPSSASRSRSVS
QERSLDEAVPSEGEREREPRGGHGVKEPTIQEEERSQDLRRTNSLMVPRGSGLAGALDEA
DTPLVLPQPELDVGKDAVLTEQEPEGSSEQALLGDVQLDMGRVISQSEPDLSCVTANTDK
AATESTSVTVAIPDVGPLVDSTVVHISNKTDGEASPLKEAEIKEEEEEVEKKQQKKEKRE
TGKAMVPHSSMFIFSTTNPIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSER
NKVLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALANA
LGTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFI
FAVIAVQLFKGKFFYCTDSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWAL
LTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALI
IITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRQTFQYRVWHFVVSPSFEY
TIMAMIALNTVVLMMKYYSAPCTYELALKYLNIAFTMVFSLECVLKIIAFGFLNYFRDTW
NIFDFITVIGSITEIILTDSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQ
SFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATG
EAWQEIMLSCLGEKGCEPDTTAPSGQSESERCGTDLAYVYFVSFIFFCSFLMLNLFVAVI
MDNFEYLTRDSSILGPHHLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCP
SKVAYKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAI
WPHLSQKMLDLLVPMPKASDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRM
EPSSLPQEIIANAKALPYLQQDPVSGLSGRSGYPSMSPLSPQEIFQLACMDPADDGQFQE
QQSLEPEVSELKSVQSSNHGIYLASDTQEHAGSGRASSMPRLTVDPQVVTDPSSMRRSFS
TIRDKRSNSSWLEEFSMERSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGRE
RGRSKERKHLLSPDVSRCNSEERGTQADWESPERRQSRSPSEGRAQTPSRQGTGSLSESS
IPSVSDTSTPRRSRRQLPPVPPKPRPLLSYSSLMRHTGSISPPADGSEGGSPLTSQALEG
NDAGLPESSNPRHAPQGQPASPPRYISEPYLALHEDSHASDCGEEETLTFEAAVATSLGR
SNTIGSAPPLRHSWQMPNGHYRRRRRGGPGPGMMCGAVSDLLSDTEEDDKC
NT seq 7356 nt   +upstreamnt  +downstreamnt
atggtgcccgagatgcgtggactgagcccaggccgcaggctgcccgagcccatcctctgc
ccggctgcgggcgggagccctgagcccagggccgcgggccaccgcctccgccacgtcctg
gccctgccggaggaggaggcatggcggccccagcagtgcgcgctactcgaagccgacgcc
tccgaggaggtgggcatgctgccggcctccccgcgctgcgccgccgccggcttcgacaac
ttcttcccggtgcaggagggcgagggcccgggctgggagggcagctccagccccttcctc
cctgtgagccccgaggtgatgaagaggcggcgcgggggtctcatcgagcagcgggacatc
atcaaggcccacgaggcgcacaagatgcagagcaccccgcaggcgcggcgcaaggagtgg
gagatggctcgcttcggggaggcagtggtcggcaggccggggtcgggcgatggagactcg
gaccagagcaggaaccggcaaggaacccccgtgccggcctccgggccggcggccgcctac
aagcagtcgaaagcgcagagggcgcggactatggctttgtacaaccctattcccgtccgg
cagaactgtttcaccgtcaacagatccttgttcatcttcggagaagataacattgtcagg
aaatacgccaagaagctcatcgattggccgccgtttgagtacatgatcctggccaccatc
attgccaactgcatcgtcttggccctggagcagcatcttcctgaggatgacaagactccg
atgtcccgcagactggagaagacagaaccctatttcattgggatcttttgctttgaagct
gggatcaaaatcgtggccctagggttcatcttccataagggctcgtacctccgcaatggc
tggaacgtcatggacttcatcgtggtcctcagtggcatcctggccactgcgggaacccac
ttcaacacacacgtggacctgaggaccctccgggccgtgcgtgtcctgaggcccctgaag
ctcgtgtcaggaatacctagcctgcagatcgtgctgaagtccatcatgaaggccatggtg
cctctcctgcagatcggcctcctgctcttctttgccatcctgatgttcgctatcatcggc
ttggaattctacagtgggaagctgcaccgagcgtgcttcacgaaccattcaggtattcta
gaaggatttgacccccctcacccatgtggcgtgcagggctgcccagctggttatgaatgc
cgggactggatcggccccaacgacgggatcacccagttcgataacatcctttttgctgtg
ctgactgtcttccagtgcatcaccatggaagggtggaccaccgtgctgtacaataccaat
gatgccttaggagccacctggaattggctgtacttcattcccctcatcatcattggatcc
ttctttgttctcaacctagtcctgggagtgctttccggggaattcgccaaagagagagag
agagtggagaaccggagagctttcatgaaactgcggcgccagcagcagatcgagcgggag
ctgaatggataccgtgcctggatagacaaagcagaggaagtcatgcttgctgaagaaaat
aaaaatgcaggaacatcagccttagaagtgcttcgaagggccaccatcaaaaggagccgg
acggaggccatgacgagagactccagtgatgagcactgtgttgatatctcatctgtgggc
acacctctcgcccgagccagcatcaaaagcgcgaaggtggatggggcctcctatttccgg
cacaaggagaggcttctgcgcatctctatccgccacatggtgaaatcccaggtgttttac
tggatcgtgctgagcctcgtggctctcaacaccgcctgtgtggccatcgtccatcacaac
cagccccagtggctcacccacctcctctactatgcagagtttttgtttctgggactcttc
ctcctggagatgtctctgaagatgtacggcatggggcctcgcctttacttccattcttca
ttcaactgctttgattttggggtcacagtggggagcatctttgaagtggtctgggcaatc
ttcagacctggcacgtcttttggaatcagtgtcttgcgagctctccgacttctaagaatc
tttaaaataaccaagtattgggcatccctacggaatttggtggtctccttgatgagttcc
atgaagtctatcatcagtttgctcttcctcctcttcctcttcatcgtggtctttgctctc
ctaggaatgcagctctttggaggcaggttcaactttaatgacgggactccttcagccaac
ttcgacaccttccctgcagccatcatgactgtcttccagatcctgacgggcgaggactgg
aacgaggtgatgtacaacgggatccgctcccagggcggggtcagctcgggcatgtggtca
gccatctatttcattgtgctcaccttgtttggaaactacacgctgctgaatgtgttcttg
gccatcgccgtggacaatctggccaatgcccaggagctgacgaaggatgagcaggaagaa
gaggaggctttcaaccagaagcacgccctgcagaaggccaaggaggtcagcccgatgtct
gcacccaacatgccttccatcgaaagagacagaaggagaagacaccacatgtcgatgtgg
gagccacgcagcagccacctgagggagcggaggcgccgacaccacatgtcggtgtgggag
cagcgcaccagccagctgaggaggcacatgcagatgtccagccaggaggccctcaacaag
gaggaggccccgcccatgaaccccctcaaccccctcaaccccctgagccccctcaacccg
ctcaacgcccaccccagcctctaccggaggcccaggcccatcgaggggctggccctgggc
ctgggtctggagaagtgcgaggaagagcgcatcagccgtggggggtccctcaagggggac
ggaggggacctggaccacccgaggagccccctgtccctgggcaaacgggagccgccgtgg
ctggccaggccgtgtcatggcaactgtgacccgacccagcaggaggcagggggcggggag
accgtggtgacctttgaggaccgggccaggcacaggcagagccagcggcgcagccggcac
cgccgagtcaggacggagggcagggagccctcctctgcctcccggagcaggtccgtcagc
caggagcggagtctggatgaagctgtgcccagcgagggggagagggagcgcgagcccagg
ggcggccacggggtcaaggagcccacaatccaggaggaagagcgatcccaggacttaagg
aggaccaacagtctgatggtgcccagaggctccgggctggcaggagccctcgatgaggcc
gacacaccccttgtcctgccccagccagagctggatgtgggaaaggacgcggtgctgaca
gagcaagagccggagggcagcagtgagcaagccctgctgggcgatgtgcagctggacatg
ggccgggtcatcagccagagtgagcccgacctctcctgtgtcacagccaacacggacaag
gccgccaccgagagcaccagcgtcactgtcgccatccccgacgtgggccccttggtggac
tcaaccgtggtgcacatcagcaacaagactgatggagaagccagtcccttgaaggaggca
gagatcaaggaggaggaggaggaggtggagaagaagcagcagaagaaggagaagcgtgag
acgggcaaagccatggtgcctcacagctcaatgttcatctttagcaccaccaacccgatc
cgcagggcctgccactacatcgtgaacctgcgctactttgaaatgtgcatcctcctggtg
atcgcagccagcagcatcgccctggcggccgaggaccccgtcctgaccaactcggagcgc
aacaaagtgctgaggtactttgactatgttttcaccggcgtgttcacctttgagatggtt
ataaagatgatagaccagggcttgatcctgcaggatgggtcctacttccgagacctgtgg
aacatcctggactttgtggtggtggtaggcgcattggtggcctttgcgctggcgaatgct
ttgggaaccaacaaggggcgggacatcaagaccatcaaatccctgcgggtgctccgggtg
ctgcgaccactgaagaccatcaagcgcctgcccaagctcaaggctgtcttcgactgtgtg
gtgacctccttgaaaaacgtcttcaacatactcattgtctataaactcttcatgttcatc
tttgctgtcatcgcggttcagcttttcaagggcaagttcttctattgcacggacagttcc
aaggacacagagaaggagtgcataggcaactatgttgatcacgagaagaacaagatggag
gtgaaaggccgagaatggaagcgccacgaattccactacgacaacatcatctgggccctg
ctgaccctcttcaccgtctccacaggggaagggtggcctcaagttttgcagcattctgtc
gatgtgaccgaggaggaccgaggcccgagccgcagcaaccgcatggagatgtccatcttt
tacgtggtctactttgtggtcttccctttcttcttcgtcaacatctttgtggcgcttatc
atcatcaccttccaggagcagggggacaagatgatggaggaatgcagcctggagaagaac
gagagggcgtgcatcgacttcgccatcagcgccaaacccctcacccgctatatgccccag
aaccggcagaccttccagtaccgcgtgtggcacttcgtggtgtccccgtcctttgagtac
accatcatggccatgatcgccctcaacaccgtcgtgctgatgatgaagtactattccgct
ccctgtacatatgaactggccctgaagtacctgaatatcgccttcaccatggtgttttcc
ctggagtgtgtcctaaagatcattgcctttggcttcttgaactatttccgagacacctgg
aatatcttcgacttcatcaccgtgattgggagcatcacagaaattattctgacagacagc
aagctggtgaacaccagtggcttcaacatgagctttctgaagctcttccgagctgcccgc
ctcatcaagctcctgcgtcagggctacaccatccggattttactgtggacctttgtacag
tcctttaaggccctcccctacgtctgccttctgattgccatgcttttcttcatctacgcc
atcatcggaatgcaggtgtttggaaacataaagttggatgaggagagtcacatcaaccgg
cacaacaacttccggagtttctttgggtccctgatgctactcttcaggagcgccacgggc
gaggcctggcaggagataatgctgtcgtgtctcggggagaaaggctgtgagcccgacacc
accgccccgtcagggcagagcgagagtgagcgctgcggcaccgacctggcctacgtttac
tttgtctccttcatcttcttctgctccttcttgatgctcaacctgtttgttgctgtcatc
atggacaactttgagtacctgactcgggactcatccatcctggggcctcaccacctggac
gagtttgtccgtgtctgggcagaatatgacagagctgcatgtggccgcatccattacact
gagatgtatgaaatgctgactctcatgtcaccaccgctaggcctcggcaagagatgtccc
tccaaggtggcatataagaggttggtcctgatgaatatgcccgtggctgaggacatgacc
gtccacttcacttccacgcttatggctctaatccggacggctctggacattaaaatcgcc
aaaggtggtgcagacaggcagcagctagactcggagctgcagaaggagaccctggccatc
tggcctcacctgtcccagaagatgctcgatctgcttgtgcccatgcccaaagcctctgac
ctgacggtgggcaaaatctatgcagcaatgatgatcatggactactataaacagagcaag
gtgaagaagcagaggcagcagctggaggagcagaaaaatgcacccatgttccagcgcatg
gagccttcatctctgcctcaggagatcatcgctaatgccaaagccctgccttatctccag
caggaccccgtttcaggcctgagtggccggagtggatacccttcgatgagtccactctcc
ccgcaggaaatattccagttggcttgtatggacccagccgatgatggacagttccaggaa
cagcagtctctggagccagaggttagtgaattaaaaagcgtgcagtcctctaaccatggc
atctaccttgcttcggacacccaggagcatgcgggatccgggagggcatcctctatgcca
cgcctgactgtggatccccaggtggtgacagaccctagctccatgaggcgttccttctcc
accatccgggataagcgctccaattcctcgtggctggaggagttctccatggagcgaagc
agcgaaaacacctacaagtcgcgtcgccggagttaccactcctccctgaggctgtcggcc
caccgcctgaactctgactcaggccacaagtccgacacccaccgctcagggggcagagag
cgggggcgatcgaaagagcgaaagcatcttctctctcccgacgtctctcgctgcaactcc
gaggaacgagggacccaggccgactgggagtccccagagcgtcgtcagtccaggtctccc
agcgagggcagggcacagacccccagcagacagggcacagggtccctgagcgaaagctcc
atcccctccgtctctgacaccagcaccccaagacgaagtcgtcggcagctcccacccgtc
cctccaaagcctcggcccctcctttcctacagctccctgatgagacacactgggagcatc
tccccacctgctgatggaagcgagggtggctccccactgacctcccaagctctggagggc
aacgatgcgggcctgcccgagtcttccaacccccggcacgcaccacagggccagcctgcc
tcccctccacgctacatctccgagccctacctggccctgcacgaagactcccacgcctcg
gactgtggcgaggaggagacgctcacctttgaggcagctgtggccaccagcctgggccgc
tccaacaccatcggctctgccccgcccctgcggcacagctggcagatgcccaacgggcac
tatcggcggcggaggcgtggggggcctggacccggcatgatgtgtggagccgtcagcgac
ctcctgagtgacacggaagaagacgataaatgctag

DBGET integrated database retrieval system