KEGG   Sus scrofa (pig): 100512048
Entry
100512048         CDS       T01009                                 

Gene name
CCNE2
Definition
(RefSeq) G1/S-specific cyclin-E2
  KO
K06626  G1/S-specific cyclin-E1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04110  Cell cycle
ssc04114  Oocyte meiosis
ssc04115  p53 signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04218  Cellular senescence
ssc04934  Cushing syndrome
ssc05161  Hepatitis B
ssc05162  Measles
ssc05165  Human papillomavirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05169  Epstein-Barr virus infection
ssc05200  Pathways in cancer
ssc05203  Viral carcinogenesis
ssc05206  MicroRNAs in cancer
ssc05215  Prostate cancer
ssc05222  Small cell lung cancer
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100512048 (CCNE2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100512048 (CCNE2)
   04114 Oocyte meiosis
    100512048 (CCNE2)
   04115 p53 signaling pathway
    100512048 (CCNE2)
   04218 Cellular senescence
    100512048 (CCNE2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100512048 (CCNE2)
   05206 MicroRNAs in cancer
    100512048 (CCNE2)
   05203 Viral carcinogenesis
    100512048 (CCNE2)
  09162 Cancer: specific types
   05226 Gastric cancer
    100512048 (CCNE2)
   05215 Prostate cancer
    100512048 (CCNE2)
   05222 Small cell lung cancer
    100512048 (CCNE2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100512048 (CCNE2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100512048 (CCNE2)
   05161 Hepatitis B
    100512048 (CCNE2)
   05162 Measles
    100512048 (CCNE2)
   05169 Epstein-Barr virus infection
    100512048 (CCNE2)
   05165 Human papillomavirus infection
    100512048 (CCNE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ssc03032]
    100512048 (CCNE2)
   03036 Chromosome and associated proteins [BR:ssc03036]
    100512048 (CCNE2)
DNA replication proteins [BR:ssc03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100512048 (CCNE2)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100512048 (CCNE2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100512048
NCBI-ProteinID: NP_001230860
Ensembl: ENSSSCG00000006095
UniProt: A0A4X1U348 F1RY56
LinkDB
Position
4
AA seq 405 aa
MSRRSSRLQAKQQPQSSQTDSPQEAQIIQTKKRKTTQDVKKRKEEKVTKKHQYEIRNCWP
PVLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSQDVWLNMLK
KETRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKD
INKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELC
PVTVISWLNLFLQVDALKDAPKVLLPQYSQEKFIQIAQLLDLCILAIDSLEFQYRILAAA
ALCHFTSIEVVKKASGLEWDNISECVDWMVPFVSVVKSTSPVKLKIFKKISMEDRHNIQT
HTNYLAMLDEANYVNTFRKGGQLSPVCNGGIMTPPKSTEKPPAKH
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgtcaagacgcagtagccgtttacaagctaaacagcagccccagtccagtcagacggat
tcccctcaagaagcccaaataattcagaccaagaaaagaaaaacgacccaggatgtcaaa
aaaagaaaagaggagaaggtcactaagaaacatcaatatgagattaggaattgttggcca
cctgtattatctggggggatcagtccttgcattattattgaaacaccccacaaagaaata
ggaacaagtgacttctccagatttacaaattacagatttaaaaatctttttattaatcct
tcacctttgcctgatttaagctggggatgctcacaggatgtttggctaaacatgttaaaa
aaagagaccagatatgttcatgacaaacattttgaagttctgcattctgacttggaacca
cagatgaggtcaatacttctagactggcttttagaggtatgtgaagtatacacacttcat
agggaaacattttatcttgcacaagacttttttgatagatttatgttgacacaaaaggat
ataaataaaaatatgcttcagcttattggaattacctcattattcattgcttccaaactt
gaggaaatctacgctcctaagctccaagagtttgcgtatgtcactgatggtgcttgcagt
gaagaggatatcttaaggatggaactcattatattaaaggctttaaaatgggaactttgt
cctgtgacggtcatctcctggctaaatctcttcctccaagttgatgctcttaaagatgct
cctaaagttcttctacctcagtattctcaggaaaagttcatccagatagctcagcttttg
gatctgtgcattctagccatcgattcactagagttccagtatagaatactggcggctgct
gctttgtgccatttcacgtctattgaagtggtcaagaaagcctcaggtttggaatgggac
aacatatctgaatgtgtcgactggatggtgcctttcgtcagtgtagtaaaaagtaccagc
ccagtgaagctgaagatttttaagaagatttctatggaagacagacacaatatacagacg
catacaaattatctggctatgctggatgaagcaaattatgttaacaccttcagaaaaggg
ggacagttatcaccagtgtgcaatggaggcattatgacaccacccaagagcacagaaaaa
ccaccagcgaaacactaa

KEGG   Sus scrofa (pig): 100523248
Entry
100523248         CDS       T01009                                 

Gene name
CCNE1
Definition
(RefSeq) G1/S-specific cyclin-E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04110  Cell cycle
ssc04114  Oocyte meiosis
ssc04115  p53 signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04218  Cellular senescence
ssc04934  Cushing syndrome
ssc05161  Hepatitis B
ssc05162  Measles
ssc05165  Human papillomavirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05169  Epstein-Barr virus infection
ssc05200  Pathways in cancer
ssc05203  Viral carcinogenesis
ssc05206  MicroRNAs in cancer
ssc05215  Prostate cancer
ssc05222  Small cell lung cancer
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100523248 (CCNE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100523248 (CCNE1)
   04114 Oocyte meiosis
    100523248 (CCNE1)
   04115 p53 signaling pathway
    100523248 (CCNE1)
   04218 Cellular senescence
    100523248 (CCNE1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100523248 (CCNE1)
   05206 MicroRNAs in cancer
    100523248 (CCNE1)
   05203 Viral carcinogenesis
    100523248 (CCNE1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100523248 (CCNE1)
   05215 Prostate cancer
    100523248 (CCNE1)
   05222 Small cell lung cancer
    100523248 (CCNE1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100523248 (CCNE1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100523248 (CCNE1)
   05161 Hepatitis B
    100523248 (CCNE1)
   05162 Measles
    100523248 (CCNE1)
   05169 Epstein-Barr virus infection
    100523248 (CCNE1)
   05165 Human papillomavirus infection
    100523248 (CCNE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ssc03032]
    100523248 (CCNE1)
   03036 Chromosome and associated proteins [BR:ssc03036]
    100523248 (CCNE1)
DNA replication proteins [BR:ssc03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100523248 (CCNE1)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100523248 (CCNE1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Connexin50
Other DBs
NCBI-GeneID: 100523248
NCBI-ProteinID: XP_005653322
Ensembl: ENSSSCG00000002855
LinkDB
Position
6
AA seq 410 aa
MPREKKERDAKEPDTMKEESGTDVSVRSRKRKANVAVFLQDPDEDVAKIDRTVRSQCGNQ
PWDNNAACENPCSFIPTPDKEEDELVYPNSVYKPQSCTPSRASPLPILNWANREEVWKIM
LNKEKTYLRDKHLMQRHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ
QNVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELIIMKALKWH
LSPLTIVSWLNVYMQVAYLNDFYEVLLPQYPQQIFIQIAELLDLCVLDVGCLEFPYGVLA
ASALYHFSSSELMQKVSGYQWCDIEKCVKWMVPFAMVIRETGSSKLKHFRGVPAEDAHNI
QTHINSLDLLDKAQAKKAILSEENRISPLPTGVLTPPPSSKKQSSGQGTA
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgccgagggagaagaaggaaagggatgcgaaggaacctgacactatgaaagaggaaagt
ggcactgatgtctctgttcgctccaggaaaaggaaggcaaatgtggccgtttttttgcaa
gatccagatgaagatgtggccaaaattgacagaactgtgagaagccagtgtggcaatcag
ccttgggacaataatgcagcctgtgaaaacccctgttccttcattcccacacctgacaaa
gaagaggatgagcttgtgtacccaaattctgtgtataagcctcagagttgcacaccatcc
agagcctcgccactgcctatactgaactgggcaaatagagaggaggtatggaaaatcatg
ttaaacaaggaaaagacgtacttgagggataagcaccttatgcagcggcaccctcttctg
cagcctaaaatgcgagcgattcttctggattggttaatggaggtgtgtgaagtctataaa
cttcatagagagacattttacttggcacaggatttctttgatcggtatatggcaacacaa
caaaatgttgtaaaaacgcttttacagcttattgggatttcatctttatttattgctgcc
aaacttgaggaaatctaccctccaaagttgcaccagtttgcttatgttacagatggggct
tgttcaggagatgaaattcttaccatggaattaatcattatgaaggcccttaagtggcat
ctcagtcccctgaccattgtgtcctggctgaatgtatacatgcaggttgcatatctaaat
gatttttatgaagtgctcctgccacagtatccccagcaaatcttcatacagatcgcagag
ctcctagatctctgtgtcctggatgttggctgcttagaatttccctatggtgtacttgct
gcttctgccttgtatcatttctcttcatccgagttgatgcagaaggtttcagggtatcag
tggtgtgatatagagaagtgtgtcaagtggatggttccatttgccatggttataagggag
acaggaagctcaaaacttaagcacttcagaggggttcctgctgaagatgcccataacatc
cagacccatataaacagcttggatttgctggacaaagcccaagcaaagaaagccatattg
tctgaagaaaataggatttctcctctccccactggagtcctcaccccgccaccgagcagt
aagaagcagagcagtgggcagggaacagcatga

DBGET integrated database retrieval system