KEGG   Sus scrofa (pig): 100512749
Entry
100512749         CDS       T01009                                 

Gene name
SHH
Definition
(RefSeq) sonic hedgehog protein preproprotein
  KO
K11988  sonic hedgehog
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04340  Hedgehog signaling pathway
ssc04360  Axon guidance
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05217  Basal cell carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100512749 (SHH)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100512749 (SHH)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100512749 (SHH)
   05205 Proteoglycans in cancer
    100512749 (SHH)
  09162 Cancer: specific types
   05226 Gastric cancer
    100512749 (SHH)
   05217 Basal cell carcinoma
    100512749 (SHH)
Peptidases and inhibitors [BR:ssc01002]
 Cysteine peptidases
  Family C46: hedgehog family
   100512749 (SHH)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Heparin
  Morphogens
   100512749 (SHH)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Vint
Other DBs
NCBI-GeneID: 100512749
NCBI-ProteinID: NP_001231442
Ensembl: ENSSSCG00000016416
UniProt: E2J596
LinkDB
Position
18
AA seq 458 aa
MLLLARCLLVMLISSLLLCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASG
RYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAFSVMNQWPGV
KLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAH
IHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLRPGDRVLAADDEGRLLYSDFLT
FLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNNSAAWEPEALSGAGRPPGGAPG
RRALFASRVRPGQHVYVVAERGGDRRLLPAAVHSVTLREEATGAYAPLTAQGTILINRVL
ASCYAVIEEHSWAHRAFAPFRLAHALLAALAPSRTDRGGDGDGGGGGRVPPPAPAAPGVA
DAPGAVGIHWYSQLLYQIGTWLLDSEALHPLGMAVKSS
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgctgctgctggcgagatgcctgctggtgatgctcatctcctccctgctcctgtgctcg
gggctggcgtgcggacccggcagggggttcgggaagaggcggcaccccaaaaaactgacc
cctttagcctacaagcagtttatccccaacgtggcggagaagaccctaggggccagcgga
agatacgaagggaagattacacgaaactcagagcgatttaaggaactcacccccaattac
aaccccgacatcatatttaaggatgaagaaaacactggagccgaccggctgatgactcag
agatgcaaggacaagctgaatgccttagccttctccgtgatgaaccagtggcccggagtg
aagctgcgggtgaccgagggctgggatgaggacggccaccactcggaggagtcgctgcat
tacgaaggccgcgcggtggacattaccacctcggaccgggatcgcagcaagtacggcatg
ctggcgcgcctggccgtggaggccggcttcgactgggtctactacgagtccaaagcgcac
atccactgctcggtgaaagcagagaactcggtggcggccaaatcgggcgggtgcttcccg
ggctcggccacggtgcacctcgagcagggcggcaccaagctggtgaaggacctgcgcccc
ggggaccgcgtgctggcggcagacgacgaaggccggctgctctacagcgacttcctcacc
ttcttggaccgcgacgacggcgccaagaaggtcttctacgtgatcgagacgagagagccc
cgcgagcgcctgctgctcaccgccgcgcacctgctcttcgtcgcgccgcacaacaactcg
gccgcctgggagcccgaggcgctgtcgggcgccgggcggccgccggggggcgcgccggga
cgccgggcgctcttcgccagccgcgtgcgcccgggccagcacgtgtacgtggtggcagag
cgcggcggggaccgccggctgctgccggccgccgtgcacagcgtgacgctgcgcgaggag
gccaccggcgcgtacgcgccgctgacggcgcagggcaccatcctcatcaaccgggtgctg
gcgtcgtgctacgcggtcatagaggagcacagctgggcgcaccgggccttcgcgcccttc
cgcctggcgcacgcgctcctggccgcgctggcgccctcgcgcacggaccgcggcggggac
ggcgacggcgggggcggcggccgcgtccccccgcccgcgccggctgcgccaggggtggcc
gacgccccgggtgccgtgggcatccactggtactcgcagctgctctaccaaataggcacc
tggctgttggacagcgaggctttgcatccgctgggcatggcggtcaagtccagctga

DBGET integrated database retrieval system