KEGG   Sus scrofa (pig): 100513197
Entry
100513197         CDS       T01009                                 

Gene name
DDB2
Definition
(RefSeq) DNA damage-binding protein 2 isoform X2
  KO
K10140  DNA damage-binding protein 2
Organism
ssc  Sus scrofa (pig)
Pathway
ssc03420  Nucleotide excision repair
ssc04115  p53 signaling pathway
ssc04120  Ubiquitin mediated proteolysis
ssc05161  Hepatitis B
ssc05169  Epstein-Barr virus infection
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05210  Colorectal cancer
ssc05212  Pancreatic cancer
ssc05213  Endometrial cancer
ssc05214  Glioma
ssc05216  Thyroid cancer
ssc05217  Basal cell carcinoma
ssc05218  Melanoma
ssc05220  Chronic myeloid leukemia
ssc05222  Small cell lung cancer
ssc05223  Non-small cell lung cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100513197 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    100513197 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100513197 (DDB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100513197 (DDB2)
   05202 Transcriptional misregulation in cancer
    100513197 (DDB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100513197 (DDB2)
   05212 Pancreatic cancer
    100513197 (DDB2)
   05225 Hepatocellular carcinoma
    100513197 (DDB2)
   05226 Gastric cancer
    100513197 (DDB2)
   05214 Glioma
    100513197 (DDB2)
   05216 Thyroid cancer
    100513197 (DDB2)
   05220 Chronic myeloid leukemia
    100513197 (DDB2)
   05217 Basal cell carcinoma
    100513197 (DDB2)
   05218 Melanoma
    100513197 (DDB2)
   05213 Endometrial cancer
    100513197 (DDB2)
   05224 Breast cancer
    100513197 (DDB2)
   05222 Small cell lung cancer
    100513197 (DDB2)
   05223 Non-small cell lung cancer
    100513197 (DDB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100513197 (DDB2)
   05169 Epstein-Barr virus infection
    100513197 (DDB2)
Ubiquitin system [BR:ssc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     100513197 (DDB2)
DNA repair and recombination proteins [BR:ssc03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      100513197 (DDB2)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40
Other DBs
NCBI-GeneID: 100513197
NCBI-ProteinID: XP_003122861
Ensembl: ENSSSCG00000013243 ENSSSCG00000027776
UniProt: F1SIC1
LinkDB
Position
2
AA seq 427 aa
MAPRKRPETQKTPEVVLRPKSKRNRSPRELEPEAKKLCLKGPGSSRRSDSGCLWAGLASL
RVPAPCSSIIRALHHYKLGRTSWPSLQQGLQQSFLHTLASYRIFQKAAPFDRRATSLAWH
PTHPRILAVGSKGGDILLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNANQFFTSSMEGT
TRLQDFKGNTLRVFASSGTCNIWFCSLDVSVRSRVVVTGDNVGHVILLNLDGKELWNLRM
HKKKVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKSSFLYSLPHRHPVNAALFSPDG
ARLLTTDQKSEIRVYSASQWDCPPSLISHPHRHFQHLTPIKATWHPRYNLIVVGRYPDPN
FKSCTPHELRTIDVFDGSSGKMMYQLYDPESSGIMSLNEFNLMGDTLASVMGYHILIWSQ
EEAGMRK
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggctcccaggaaacgcccagaaacccagaagacccctgaggtggttttacgccccaag
agcaagaggaacagaagcccccgtgagctggagcccgaggccaagaagctctgtttgaag
ggccccggttccagcagaagatctgactcaggctgcctttgggcggggttggctagcctg
cgggtcccggcaccatgcagcagcatcatcagggctctccatcattataagctgggcaga
acctcctggccatcactacagcagggtctccagcagtcctttttgcacactctggcttct
taccggatattccaaaaggctgccccttttgacaggagggccacatccctggcatggcac
ccaactcaccccaggatcctggctgtgggctccaaagggggagatatcttgctctggaac
tttggcataaaggacaaacccaccttcattaaagggattggagctggagggagcatcact
gggctgaagtttaaccctctcaatgccaaccagtttttcacctcctcaatggagggaaca
actaggctgcaagactttaaaggcaacactctccgagtttttgccagctcaggcacctgc
aacatctggttttgcagcctggatgtgtcggtcagaagccgagtggtggtcacaggagac
aatgtggggcatgtgatcctgctgaacttggacggcaaggagctttggaatctgagaatg
cacaaaaagaaagtgacccatgtggccttgaacccatgctgtgattggttcctggccaca
gcctccgtagatcaaacagtgaaaatctgggacctgcgccaggttagagggaaatccagc
ttcctctactcgctgccgcacaggcatcctgtcaacgcagctcttttcagtcccgacgga
gcccggctgctgaccactgaccagaagagcgagattcgggtttactctgcctcccagtgg
gactgtcccccaagtctgatctcacaccctcaccgccacttccagcacctgacacccatc
aaggcaacctggcatcctcggtacaacctcattgtcgtgggccgatacccagatcctaat
ttcaaaagttgtacccctcacgaattaagaacaatcgatgtgtttgatggaagctcagga
aagatgatgtatcagctgtatgacccagaatcctctggtatcatgtcgctcaatgagttc
aatctcatgggggacacgctggcctctgtgatgggttatcacattctcatttggagccag
gaggaagctgggatgcggaaatga

DBGET integrated database retrieval system