KEGG   Sus scrofa (pig): 100513637Help
Entry
100513637         CDS       T01009                                 

Gene name
GANC
Definition
(RefSeq) neutral alpha-glucosidase C isoform X1
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00052  Galactose metabolism
ssc00500  Starch and sucrose metabolism
ssc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100513637 (GANC)
   00500 Starch and sucrose metabolism
    100513637 (GANC)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100513637 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100513637
NCBI-ProteinID: XP_020952865
Ensembl: ENSSSCG00000004729
LinkDB All DBs
Position
1
AA seq 937 aa AA seqDB search
MEAAGKEEISVEDEAVDKNIFKDCSKIAFYRIYSPLEADNHQWFSDICILRICRRQKQQL
SKKSTYRALLDSVTTGKDSTRFQIINEVAKVPLLAEVYGIEGNIFRLKINEETPLKPRYE
VPDVLTSKPSTVRLISCSGDTGSLVLADGKGDLKCHITANPFKVDLVSEEEVVMSINSLG
QLYFEHLQIPPKQRATKENEEDASVDTTQENPEELGLWEEKFGNFVDVKVNGPTSIGLDF
SLHGFEHLYGIPQHAESHQLKNTRDGEAYRLYNLDVYGYKIYDKLGIYGSVPYLLAHKVG
RTLGIFWLNASETLVEINTEPAIKYTLTQMGPVAAKQKVESRTDVHWMSESGIIDVFLLT
GPTPSDIFKQYSYLTGTQAMPPLFSLGYHQCRWNYEDEQDVKAVDAGFDEHDIPYDVMWL
DIEHTEGKRYFTWDKKRFPNPKRMQELLRSKKRKLVVISDPHIKIDPDYSVYAKAKEQGF
FVKNHEGGDFEGVCWPGLSSYLDFTNPKVREWYSSLFAFPVYQGSTDILYIWNDMNEPSV
FRGPELTMQKNAIHHGNWEHRELHNLYGFYQQMATAEGLIQRAKGKERPFVLTRSFFAGS
QKYGAVWTGDNTAEWSYLKISIPMLLTLSITGISFCGADVGGFIGNPEAELLVRWYQAGA
YQPFFRGHATMNTKRREPWLFGEEYTRPIREAMRERYALLPYWYSLFYSAHVASQPIMRP
LWIEFPDELETFGVEDEYMLGSALLVHPVTEPKATVVDVFLPGSNEVWYDSKTFAHWGGA
CTVKIPVALDTIPVFQRGGSVVPIKTTIGKSTGCMSDSPYGLHVALSTKGSAVGEFYLDD
GHSFQYLHQKQFLHRKFSFSSGVLINSCADERGRYSSKCVVEQVFVLGLRKRPSSVTARS
SDGKAQPVAFSYCARTSTLSLEKLSLNIGSDWKVHIQ
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagctggcaaagaggaaatcagtgttgaagatgaagctgtggataaaaacatt
ttcaaagactgcagcaagattgctttctacagaatatatagtcctttggaggctgacaat
caccagtggttctcagacatctgtatactccgtatctgtagacgtcagaaacagcagctc
tccaagaagtctacctatcgggcattactagactcagtcacaacaggcaaagatagcacc
aggttccaaatcatcaatgaagtagcaaaggttcctctactggctgaagtttatggtata
gagggaaatattttcaggcttaaaatcaatgaggaaacacccctgaaacccaggtatgaa
gttcctgatgtcctcacaagcaaaccaagcactgtaaggctgatttcatgctcaggagat
acaggaagtctggtattggcagatggcaaaggagatctgaagtgtcatatcacagcaaac
cctttcaaggtagacttggtatctgaagaagaagttgttatgagcataaactccctgggc
caactgtactttgagcacctgcagattcctcccaaacaaagagctaccaaggaaaatgag
gaggatgcatcagttgacaccactcaggagaatccagaggaactaggcctgtgggaggag
aaatttggaaattttgtggatgtcaaagttaatggtcctacgtccattggtttggatttc
tccttgcatggatttgaacatctctatgggatcccacaacatgcagaatcacaccaactt
aaaaataccagagatggagaggcttaccgtctttataatctagatgtatatggatataaa
atatatgacaaactgggcatttatgggtcagtgccttatctccttgctcacaaagtgggc
aggactctaggcattttttggctaaatgcctctgaaacgctagtggagatcaatacagaa
cctgctataaagtatacactgacccagatgggtccagttgctgctaaacaaaaggtcgaa
tctcgaactgatgtgcactggatgtcggagagtggaatcattgatgtttttctgctgaca
ggacctacaccttctgacatctttaagcagtactcataccttacaggcacacaagccatg
ccccctctcttctccttggggtaccatcagtgccgttggaactatgaagatgagcaggat
gtaaaagcagtggatgcaggatttgatgaacatgacattccttatgatgtcatgtggctg
gacatagagcacaccgagggcaagaggtactttacctgggacaagaaaagattcccaaac
cccaaaaggatgcaagagctgctcaggagcaaaaaacgtaagcttgtggtcatcagtgac
ccccacatcaagattgaccctgactactcagtgtatgctaaggcaaaagaacagggcttc
tttgtgaagaaccatgaagggggggactttgaaggtgtatgctggcctggtctctcctct
tacctggatttcaccaaccccaaggtcagagaatggtactccagtctttttgctttccct
gtttatcagggatctacagatatcctctacatatggaacgacatgaatgagccctctgtc
tttagagggccagaactaaccatgcagaagaacgccattcaccacggcaactgggagcac
cgggaacttcacaacctctatggcttttatcagcaaatggccactgcagaaggactgatc
caacgagctaaagggaaggagagaccctttgttctgacacgttctttctttgctggatca
cagaagtatggtgctgtgtggacaggagacaacacagcagaatggagctaccttaaaatt
tctatccctatgttactcaccctcagcattactgggatctctttttgtggagcggatgta
ggcggcttcattgggaatccagaagcagaactgctagtgcggtggtaccaggctggagcc
tatcaaccctttttccgtggccatgccaccatgaacaccaagcgacgagaaccctggctc
ttcggagaggagtacacccggcccatccgagaagccatgagagagcgttatgccctcctg
ccctactggtattctctgttctactctgcacacgtggcttcccagcccatcatgaggcct
ctgtggatagagttccctgacgaattggagacttttggtgtagaagatgaatacatgctg
ggaagtgctttattggttcatccagtcacagaaccaaaagctactgtggttgatgtattt
ctgccaggatcaaatgaggtctggtatgactccaagacatttgctcattggggaggagca
tgtactgtaaagatcccagtagccttggacactataccagtgtttcaacgaggtggaagt
gtggtaccaataaagacaactataggaaaatccacgggctgcatgagtgattccccatat
ggactccacgtggccctaagcactaagggttctgccgtgggtgaattctatctcgatgat
ggccattccttccagtacctccatcagaagcagttcttgcacaggaagttttcgttctcc
tcaggtgttttgatcaacagttgtgccgacgagcggggtcgttattccagcaagtgtgtg
gtggagcaggtctttgtcctgggcctcaggaagcggccctcttctgtgactgcccgctcc
tccgatggtaaagctcagcctgtggctttttcatactgtgccagaacgtccaccctgagc
cttgagaagctctcactcaacattggcagtgactggaaggtccacatccagtga

DBGET integrated database retrieval system