KEGG   Sus scrofa (pig): 100514516
Entry
100514516         CDS       T01009                                 

Gene name
CSNK1A1
Definition
(RefSeq) casein kinase I isoform X4
  KO
K08957  casein kinase 1, alpha [EC:2.7.11.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04310  Wnt signaling pathway
ssc04340  Hedgehog signaling pathway
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100514516 (CSNK1A1)
   04340 Hedgehog signaling pathway
    100514516 (CSNK1A1)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100514516 (CSNK1A1)
   05226 Gastric cancer
    100514516 (CSNK1A1)
   05224 Breast cancer
    100514516 (CSNK1A1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100514516 (CSNK1A1)
   05022 Pathways of neurodegeneration - multiple diseases
    100514516 (CSNK1A1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100514516 (CSNK1A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100514516 (CSNK1A1)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100514516 (CSNK1A1)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   100514516 (CSNK1A1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Pox_ser-thr_kin APH ABC1 Kdo
Other DBs
NCBI-GeneID: 100514516
NCBI-ProteinID: XP_003124136
Ensembl: ENSSSCG00000014435
UniProt: A0A480VY41 A0A4X1T6B8
LinkDB
Position
2
AA seq 337 aa
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKN
LTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKK
MSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTM
LKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggcgagcagcagcggctccaaggccgagttcattgtcggagggaagtacaaactggtg
cggaagatcggctctggctccttcggggacatttacctggcgatcaacatcaccaacggc
gaggaagtggcagtgaagctagaatctcagaaggccaggcatccccagttgctgtacgag
agcaaactctataagattcttcaaggtggggtcggcatcccccacatacggtggtatggt
caggaaaaagactacaatgtgctcgtgatggacctgctcggacccagcctcgaagacctc
ttcaacttctgttccagaaggttcacaatgaaaactgtactcatgttagccgaccagatg
atcagtagaattgaatatgtgcatacaaagaactttatacacagagacattaaaccagat
aacttcctaatgggtattgggcgtcactgtaataagttattccttattgattttggtttg
gccaaaaagtacagagacaacaggacaaggcaacacataccatacagagaagataaaaat
ctcactggcactgcccgatacgctagcatcaatgcacatcttggtattgaacagagtcgc
cgagatgacatggaatcattaggatatgttttgatgtattttaatagaaccagtctgcca
tggcaaggactcaaggctgcaacaaagaagcaaaaatatgaaaaaattagcgaaaagaag
atgtccacacctgtggaagttttgtgtaaggggtttcctgcagaatttgccatgtactta
aactattgtcgtgggctgcgctttgaggaagccccggattacatgtacctgagacagcta
ttccgcattcttttcaggaccctgaatcaccaatatgactacacatttgactggacaatg
ttaaagcagaaagcagcacagcaagcagcctcttcaagtgggcagggtcagcaggcccaa
acccccacaggcaagcaaactgacaaaaccaagagtaacatgaaaggtttctaa

DBGET integrated database retrieval system