KEGG   Sus scrofa (pig): 100514612
Entry
100514612         CDS       T01009                                 

Gene name
BRAF
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X6
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc01522  Endocrine resistance
ssc04010  MAPK signaling pathway
ssc04012  ErbB signaling pathway
ssc04015  Rap1 signaling pathway
ssc04024  cAMP signaling pathway
ssc04062  Chemokine signaling pathway
ssc04068  FoxO signaling pathway
ssc04150  mTOR signaling pathway
ssc04270  Vascular smooth muscle contraction
ssc04510  Focal adhesion
ssc04650  Natural killer cell mediated cytotoxicity
ssc04720  Long-term potentiation
ssc04722  Neurotrophin signaling pathway
ssc04726  Serotonergic synapse
ssc04730  Long-term depression
ssc04810  Regulation of actin cytoskeleton
ssc04910  Insulin signaling pathway
ssc04914  Progesterone-mediated oocyte maturation
ssc04928  Parathyroid hormone synthesis, secretion and action
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05034  Alcoholism
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05210  Colorectal cancer
ssc05211  Renal cell carcinoma
ssc05212  Pancreatic cancer
ssc05213  Endometrial cancer
ssc05214  Glioma
ssc05215  Prostate cancer
ssc05216  Thyroid cancer
ssc05218  Melanoma
ssc05219  Bladder cancer
ssc05220  Chronic myeloid leukemia
ssc05221  Acute myeloid leukemia
ssc05223  Non-small cell lung cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100514612 (BRAF)
   04012 ErbB signaling pathway
    100514612 (BRAF)
   04015 Rap1 signaling pathway
    100514612 (BRAF)
   04068 FoxO signaling pathway
    100514612 (BRAF)
   04024 cAMP signaling pathway
    100514612 (BRAF)
   04150 mTOR signaling pathway
    100514612 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100514612 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100514612 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100514612 (BRAF)
   04062 Chemokine signaling pathway
    100514612 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100514612 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    100514612 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    100514612 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100514612 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    100514612 (BRAF)
   04720 Long-term potentiation
    100514612 (BRAF)
   04730 Long-term depression
    100514612 (BRAF)
   04722 Neurotrophin signaling pathway
    100514612 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100514612 (BRAF)
   05205 Proteoglycans in cancer
    100514612 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100514612 (BRAF)
   05212 Pancreatic cancer
    100514612 (BRAF)
   05225 Hepatocellular carcinoma
    100514612 (BRAF)
   05226 Gastric cancer
    100514612 (BRAF)
   05214 Glioma
    100514612 (BRAF)
   05216 Thyroid cancer
    100514612 (BRAF)
   05221 Acute myeloid leukemia
    100514612 (BRAF)
   05220 Chronic myeloid leukemia
    100514612 (BRAF)
   05218 Melanoma
    100514612 (BRAF)
   05211 Renal cell carcinoma
    100514612 (BRAF)
   05219 Bladder cancer
    100514612 (BRAF)
   05215 Prostate cancer
    100514612 (BRAF)
   05213 Endometrial cancer
    100514612 (BRAF)
   05224 Breast cancer
    100514612 (BRAF)
   05223 Non-small cell lung cancer
    100514612 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100514612 (BRAF)
   05160 Hepatitis C
    100514612 (BRAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100514612 (BRAF)
   05022 Pathways of neurodegeneration - multiple diseases
    100514612 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    100514612 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100514612 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100514612 (BRAF)
   01522 Endocrine resistance
    100514612 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100514612 (BRAF)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100514612 (BRAF)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   100514612 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like ABC1 C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 100514612
NCBI-ProteinID: XP_005654324
Ensembl: ENSSSCG00000016494
LinkDB
Position
18
AA seq 727 aa
MIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVS
SSASTDTVTSSSSSSLSVLPSSLSVFQNPTDASRSNPKSPQKPIVRVFLPNKQRTVVPAR
CGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPL
TTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVS
KFFEHHPIPQEEASLAETALTSGSSPSAPPSDSLGPQILTSPSPSKSIPIPQPFRPADED
HRNQFGQRDRSSSAPNVHINTIEPVNIDEKFPEVELQDQRDLIRDQGFRSDGGSTTGLSA
TPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVG
QRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYS
TKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSN
NIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVY
AFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKK
RDERPLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGY
GEFAAFK
NT seq 2184 nt   +upstreamnt  +downstreamnt
atgattaaattgacacaagaacatatagaggccctattggacaaatttggtggggagcat
aatccaccttcaatatatctggaggcctatgaagaatacaccagcaagctagatgccctc
cagcaaagagaacagcagttattggaatccctggggaatggaactgatttttctgtttct
agttctgcatcaacggacaccgttacatcttcttcctcttctagcctttctgtgctgcct
tcatctctttcagtttttcaaaatcccacagatgcatcacggagcaaccccaagtcacca
caaaaacctattgttagagtcttcctgcccaataaacagaggacagtggtacctgcaagg
tgtggcgttacagtccgggacagtctaaagaaagcgctgatgatgagaggtctaatccca
gagtgctgcgctgtttacagaattcaggatggagagaagaaaccaattggctgggacact
gatatttcctggcttacaggagaggaattgcatgtagaagtgttggagaatgttccactt
acaacccacaactttgtacggaaaacttttttcaccttagcattttgtgacttctgtcga
aagctgcttttccaggggttccgctgtcaaacatgtggttataaatttcaccagcgttgt
agtacagaggttccactgatgtgtgttaattatgatcaacttgatttgctgtttgtctcc
aagttctttgaacaccacccaataccacaggaggaggcctccttagcagagactgccctt
acgtctggatcatccccttctgcacccccctccgattcccttgggccccaaattctcacc
agtccgtctccttcaaaatccattccaatcccacagcctttccgaccagcagatgaagat
catcgaaatcagtttggacagagagaccggtcctcatcagctccaaatgtgcatataaac
acaatagaacccgtcaatattgatgaaaaattcccagaagtcgaattacaggatcaaagg
gacttgattagagaccaagggtttcgtagtgatggaggatccaccacaggtttgtctgcc
acgccccctgcctcattacctggctcactcactaatgtgaaagcattacagaaatctcca
ggacctcagcgagagaggaagtcatcttcatcctcagaagacaggaatcgaatgaaaaca
cttggtagacgggattcaagtgatgattgggagattcctgatgggcagatcacagtggga
caaagaattggatctgggtcgtttgggacagtctacaagggaaagtggcatggtgatgtg
gcagtgaaaatgttgaatgtgacagcacccacacctcagcagttacaggccttcaaaaat
gaagtaggagtactcaggaaaactcgacatgtgaatatcctactcttcatgggttattca
acaaagccacaactggctattgttacccagtggtgtgagggctccagcttatatcatcat
ctccacatcattgagaccaaattcgagatgatcaaacttatagatattgcacggcagact
gcacagggcatggattacttacacgccaagtcaatcatccacagagacctcaagagtaat
aatatttttcttcatgaagacctcacagtaaaaataggtgattttggtctagccacagtg
aaatctcgatggagtgggtcccatcaatttgaacagttgtctggatccattttgtggatg
gcgccagaagtaatcagaatgcaagacaaaaacccgtatagctttcagtcagacgtatat
gcttttggtattgttctgtatgaattgatgactggacagttaccttattcaaacatcaac
aacagggaccagataatttttatggtgggacgaggatatctatctccagatctcagtaag
gtacggagtaactgtccaaaggccatgaagagattaatggcagagtgcctaaaaaagaag
agagatgagagaccactctttccccaaattctcgcctctattgagctgttggcccgctca
ttgccaaaaattcaccgcagtgcatcagaaccctccttgaatcgggctggcttccaaaca
gaggattttagtctatatgcttgtgcttctccaaaaacacccatccaggcagggggatat
ggagaatttgcagccttcaagtag

KEGG   Sus scrofa (pig): 100737448
Entry
100737448         CDS       T01009                                 

Gene name
RAF1
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase isoform X1
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc01522  Endocrine resistance
ssc04010  MAPK signaling pathway
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04015  Rap1 signaling pathway
ssc04022  cGMP-PKG signaling pathway
ssc04024  cAMP signaling pathway
ssc04062  Chemokine signaling pathway
ssc04068  FoxO signaling pathway
ssc04071  Sphingolipid signaling pathway
ssc04072  Phospholipase D signaling pathway
ssc04140  Autophagy - animal
ssc04150  mTOR signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04210  Apoptosis
ssc04218  Cellular senescence
ssc04270  Vascular smooth muscle contraction
ssc04360  Axon guidance
ssc04370  VEGF signaling pathway
ssc04371  Apelin signaling pathway
ssc04510  Focal adhesion
ssc04540  Gap junction
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04613  Neutrophil extracellular trap formation
ssc04625  C-type lectin receptor signaling pathway
ssc04630  JAK-STAT signaling pathway
ssc04650  Natural killer cell mediated cytotoxicity
ssc04660  T cell receptor signaling pathway
ssc04662  B cell receptor signaling pathway
ssc04664  Fc epsilon RI signaling pathway
ssc04666  Fc gamma R-mediated phagocytosis
ssc04720  Long-term potentiation
ssc04722  Neurotrophin signaling pathway
ssc04726  Serotonergic synapse
ssc04730  Long-term depression
ssc04810  Regulation of actin cytoskeleton
ssc04910  Insulin signaling pathway
ssc04912  GnRH signaling pathway
ssc04914  Progesterone-mediated oocyte maturation
ssc04915  Estrogen signaling pathway
ssc04916  Melanogenesis
ssc04917  Prolactin signaling pathway
ssc04919  Thyroid hormone signaling pathway
ssc04921  Oxytocin signaling pathway
ssc04926  Relaxin signaling pathway
ssc04928  Parathyroid hormone synthesis, secretion and action
ssc04929  GnRH secretion
ssc04935  Growth hormone synthesis, secretion and action
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05034  Alcoholism
ssc05132  Salmonella infection
ssc05152  Tuberculosis
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05163  Human cytomegalovirus infection
ssc05164  Influenza A
ssc05165  Human papillomavirus infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05206  MicroRNAs in cancer
ssc05207  Chemical carcinogenesis - receptor activation
ssc05210  Colorectal cancer
ssc05211  Renal cell carcinoma
ssc05212  Pancreatic cancer
ssc05213  Endometrial cancer
ssc05214  Glioma
ssc05215  Prostate cancer
ssc05218  Melanoma
ssc05219  Bladder cancer
ssc05220  Chronic myeloid leukemia
ssc05221  Acute myeloid leukemia
ssc05223  Non-small cell lung cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
ssc05230  Central carbon metabolism in cancer
ssc05231  Choline metabolism in cancer
ssc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100737448 (RAF1)
   04012 ErbB signaling pathway
    100737448 (RAF1)
   04014 Ras signaling pathway
    100737448 (RAF1)
   04015 Rap1 signaling pathway
    100737448 (RAF1)
   04370 VEGF signaling pathway
    100737448 (RAF1)
   04371 Apelin signaling pathway
    100737448 (RAF1)
   04630 JAK-STAT signaling pathway
    100737448 (RAF1)
   04068 FoxO signaling pathway
    100737448 (RAF1)
   04072 Phospholipase D signaling pathway
    100737448 (RAF1)
   04071 Sphingolipid signaling pathway
    100737448 (RAF1)
   04024 cAMP signaling pathway
    100737448 (RAF1)
   04022 cGMP-PKG signaling pathway
    100737448 (RAF1)
   04151 PI3K-Akt signaling pathway
    100737448 (RAF1)
   04150 mTOR signaling pathway
    100737448 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100737448 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    100737448 (RAF1)
   04218 Cellular senescence
    100737448 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100737448 (RAF1)
   04540 Gap junction
    100737448 (RAF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100737448 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100737448 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100737448 (RAF1)
   04625 C-type lectin receptor signaling pathway
    100737448 (RAF1)
   04650 Natural killer cell mediated cytotoxicity
    100737448 (RAF1)
   04660 T cell receptor signaling pathway
    100737448 (RAF1)
   04662 B cell receptor signaling pathway
    100737448 (RAF1)
   04664 Fc epsilon RI signaling pathway
    100737448 (RAF1)
   04666 Fc gamma R-mediated phagocytosis
    100737448 (RAF1)
   04062 Chemokine signaling pathway
    100737448 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100737448 (RAF1)
   04929 GnRH secretion
    100737448 (RAF1)
   04912 GnRH signaling pathway
    100737448 (RAF1)
   04915 Estrogen signaling pathway
    100737448 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    100737448 (RAF1)
   04917 Prolactin signaling pathway
    100737448 (RAF1)
   04921 Oxytocin signaling pathway
    100737448 (RAF1)
   04926 Relaxin signaling pathway
    100737448 (RAF1)
   04935 Growth hormone synthesis, secretion and action
    100737448 (RAF1)
   04919 Thyroid hormone signaling pathway
    100737448 (RAF1)
   04928 Parathyroid hormone synthesis, secretion and action
    100737448 (RAF1)
   04916 Melanogenesis
    100737448 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100737448 (RAF1)
  09156 Nervous system
   04726 Serotonergic synapse
    100737448 (RAF1)
   04720 Long-term potentiation
    100737448 (RAF1)
   04730 Long-term depression
    100737448 (RAF1)
   04722 Neurotrophin signaling pathway
    100737448 (RAF1)
  09158 Development and regeneration
   04360 Axon guidance
    100737448 (RAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100737448 (RAF1)
   05206 MicroRNAs in cancer
    100737448 (RAF1)
   05205 Proteoglycans in cancer
    100737448 (RAF1)
   05207 Chemical carcinogenesis - receptor activation
    100737448 (RAF1)
   05230 Central carbon metabolism in cancer
    100737448 (RAF1)
   05231 Choline metabolism in cancer
    100737448 (RAF1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100737448 (RAF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100737448 (RAF1)
   05212 Pancreatic cancer
    100737448 (RAF1)
   05225 Hepatocellular carcinoma
    100737448 (RAF1)
   05226 Gastric cancer
    100737448 (RAF1)
   05214 Glioma
    100737448 (RAF1)
   05221 Acute myeloid leukemia
    100737448 (RAF1)
   05220 Chronic myeloid leukemia
    100737448 (RAF1)
   05218 Melanoma
    100737448 (RAF1)
   05211 Renal cell carcinoma
    100737448 (RAF1)
   05219 Bladder cancer
    100737448 (RAF1)
   05215 Prostate cancer
    100737448 (RAF1)
   05213 Endometrial cancer
    100737448 (RAF1)
   05224 Breast cancer
    100737448 (RAF1)
   05223 Non-small cell lung cancer
    100737448 (RAF1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100737448 (RAF1)
   05161 Hepatitis B
    100737448 (RAF1)
   05160 Hepatitis C
    100737448 (RAF1)
   05164 Influenza A
    100737448 (RAF1)
   05163 Human cytomegalovirus infection
    100737448 (RAF1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100737448 (RAF1)
   05165 Human papillomavirus infection
    100737448 (RAF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100737448 (RAF1)
   05152 Tuberculosis
    100737448 (RAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100737448 (RAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    100737448 (RAF1)
  09165 Substance dependence
   05034 Alcoholism
    100737448 (RAF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100737448 (RAF1)
   01522 Endocrine resistance
    100737448 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100737448 (RAF1)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100737448 (RAF1)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   100737448 (RAF1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like ABC1 zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 100737448
NCBI-ProteinID: XP_020925006
Ensembl: ENSSSCG00000022633 ENSSSCG00000024453
LinkDB
Position
13
AA seq 668 aa
MEHIQGAWKTISNGFGFKDAVFDGPSCISPTIVQQFGYQRRASDDGKLTDSSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSTVGDSGVPALPSLTMRRMRESVSRMPVSSQHRYSTPHAFTF
NTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIENNSLNASPRAWSRRFCLRGRDA
IRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPGSGTQEKNKIRPRGQRDSSY
YWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQLQAFRNEVAVLRKT
RHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLH
AKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSILWMAPEVIRMQ
DNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKA
MKRLVADCVKKVKEERPLFPQILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLT
TSPRLPVF
NT seq 2007 nt   +upstreamnt  +downstreamnt
atggagcacatacagggggcctggaagacgatcagcaatggttttggattcaaagacgca
gtgtttgatggccccagctgcatctcccctacaatagttcagcagtttggctatcagcgt
cgggcatcagatgatggcaaacttacggactcttctaagacaagcaacactatccgtgtt
tttttgccaaacaagcaaagaacagtggtcaatgtgcggaatggaatgagcttgcatgat
tgccttatgaaagctctcaaggtgaggggcctgcaaccagagtgctgtgcagtgttcaga
cttctccatgaacataagggtaaaaaggcacgtttagattggaatactgatgctgcctca
ttgattggagaggaacttcaagtagatttcctggatcacgttcccctaacaacacacaac
tttgctcggaagaccttcctgaagcttgctttttgtgacatctgtcagaagtttctgcta
aatggatttcgatgtcagacttgtggctacaagtttcatgaacactgtagcaccaaagta
cctactatgtgtgtggactggagtaatatcagacaactcttattgttcccaaattccact
gttggtgatagtggggtcccagcactgccttctttgacaatgcgtcggatgcgagaatct
gtttcccggatgcctgttagttcccagcacagatactccacaccccatgctttcacattc
aacacctccagcccttcctctgaaggttccctctcccagcggcagaggtcgacgtccaca
cccaatgtccacatggtcagcaccaccctgcctgtggacagcaggatgattgagaataac
agcctgaatgcttctcccagggcgtggtccagacgattttgtttgaggggaagagatgca
attcgaagtcacagtgaatcagcctcaccttcagccttgtccagcagccccaacaatctg
agcccaacgggctggtcacaaccgaaaacccctgtgccagcacagagagagcgggcgcca
ggatccgggacccaggagaaaaacaaaattaggcctcgtggacagagagattcaagctat
tactgggaaatagaagccagtgaagtgatgctttccactcggattgggtcaggctccttt
ggaactgtttataagggcaagtggcatggagatgttgcagtaaagatcctaaaggttgtt
gaccccacaccagagcagttgcaggcctttaggaatgaagtggctgtccttcgcaaaact
cggcatgtgaacatcctgctgttcatggggtacatgaccaaggacaacctggcgattgtg
acccagtggtgtgagggcagcagcctctacaaacacctgcatgtccaggagaccaagttc
cagatgttccagttgattgacattgcccggcagacggctcagggaatggactacttgcat
gcaaagaacatcatccacagagacatgaaatccaacaatatatttctccatgaaggccta
acggtgaaaattggagattttggtttggcaacagtcaagtcgcgctggagtggttctcag
caggttgaacaacctactggctccatcctgtggatggccccagaggtgatccggatgcag
gataacaacccattcagcttccagtccgacgtctactcctacggcattgtgctgtacgag
ctcatgacgggggagctcccttactcccacatcaacaaccgtgatcagatcatcttcatg
gtgggccgaggctatgcctccccagatcttagtaagctctacaagaactgcccaaaagca
atgaagaggcttgtggccgactgtgtgaagaaagttaaggaagaaaggcctctttttcct
cagatcctgtcttccatcgagctgctccaacactctctaccgaaaatcaaccggagtgct
tctgagccatccctgcaccgggcggcccacacggaggacatcaatgcctgcactctgacc
acatccccgagattgcccgtcttctag

KEGG   Sus scrofa (pig): 397601
Entry
397601            CDS       T01009                                 

Gene name
ARAF
Definition
(RefSeq) serine/threonine-protein kinase A-Raf
  KO
K08845  A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc01522  Endocrine resistance
ssc04010  MAPK signaling pathway
ssc04012  ErbB signaling pathway
ssc04068  FoxO signaling pathway
ssc04270  Vascular smooth muscle contraction
ssc04650  Natural killer cell mediated cytotoxicity
ssc04720  Long-term potentiation
ssc04726  Serotonergic synapse
ssc04730  Long-term depression
ssc04810  Regulation of actin cytoskeleton
ssc04910  Insulin signaling pathway
ssc04914  Progesterone-mediated oocyte maturation
ssc04928  Parathyroid hormone synthesis, secretion and action
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05034  Alcoholism
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05210  Colorectal cancer
ssc05211  Renal cell carcinoma
ssc05212  Pancreatic cancer
ssc05213  Endometrial cancer
ssc05214  Glioma
ssc05215  Prostate cancer
ssc05218  Melanoma
ssc05219  Bladder cancer
ssc05220  Chronic myeloid leukemia
ssc05221  Acute myeloid leukemia
ssc05223  Non-small cell lung cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    397601 (ARAF)
   04012 ErbB signaling pathway
    397601 (ARAF)
   04068 FoxO signaling pathway
    397601 (ARAF)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    397601 (ARAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    397601 (ARAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    397601 (ARAF)
   04914 Progesterone-mediated oocyte maturation
    397601 (ARAF)
   04928 Parathyroid hormone synthesis, secretion and action
    397601 (ARAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    397601 (ARAF)
  09156 Nervous system
   04726 Serotonergic synapse
    397601 (ARAF)
   04720 Long-term potentiation
    397601 (ARAF)
   04730 Long-term depression
    397601 (ARAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    397601 (ARAF)
   05205 Proteoglycans in cancer
    397601 (ARAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    397601 (ARAF)
   05212 Pancreatic cancer
    397601 (ARAF)
   05225 Hepatocellular carcinoma
    397601 (ARAF)
   05226 Gastric cancer
    397601 (ARAF)
   05214 Glioma
    397601 (ARAF)
   05221 Acute myeloid leukemia
    397601 (ARAF)
   05220 Chronic myeloid leukemia
    397601 (ARAF)
   05218 Melanoma
    397601 (ARAF)
   05211 Renal cell carcinoma
    397601 (ARAF)
   05219 Bladder cancer
    397601 (ARAF)
   05215 Prostate cancer
    397601 (ARAF)
   05213 Endometrial cancer
    397601 (ARAF)
   05224 Breast cancer
    397601 (ARAF)
   05223 Non-small cell lung cancer
    397601 (ARAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    397601 (ARAF)
   05160 Hepatitis C
    397601 (ARAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    397601 (ARAF)
   05022 Pathways of neurodegeneration - multiple diseases
    397601 (ARAF)
  09165 Substance dependence
   05034 Alcoholism
    397601 (ARAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    397601 (ARAF)
   01522 Endocrine resistance
    397601 (ARAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    397601 (ARAF)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     397601 (ARAF)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   397601 (ARAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like ABC1 zf-RING-like Pkinase_fungal APH TUG-UBL1 Kdo
Other DBs
NCBI-GeneID: 397601
NCBI-ProteinID: NP_999494
Ensembl: ENSSSCG00000012275
Vega: OTTSUSG00000004536
UniProt: O19004
LinkDB
Position
X
AA seq 606 aa
MEPPRGPPANGAEPSRAVGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCV
VYRLIKGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCLKFLF
HGFRCQTCGYKFHQHCSSKVPTVCVDMSTNRRQFYHSVQDLSGGSRQHETPSNRPLNEPL
TPQGPSSCTQHRDPEHFPFPAPANAPLQRIRSTSTPNVHMVSTTAPMDSGLVQLTAQSFN
TDAAGNRGGGDGAPRGSPSPASVSSGRKSPHSKSPSEQRERKSLADDKKKVKNLGYRDSG
YYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVAQPTAEQAQAFKNEMQVLRK
TRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQGMDYL
HAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAAEVIRM
QDPNPYSFQSDVYAYGVVLYELMTGSLPYSHIGSRDQIIFMVGRGYLSPDLSKISSNCPK
AMRRLLSDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELPACLLS
AARLVP
NT seq 1821 nt   +upstreamnt  +downstreamnt
atggagccaccacggggcccccctgccaacggggccgagccgtcccgggcagtgggcacc
gtcaaagtgtacctgcccaacaagcagcgcacggtggtgactgtccgggatggcatgagt
gtctacgactctctggacaaggccctcaaggtgcgaggtctcaatcaggattgctgcgtg
gtctaccggctcatcaaggggcgaaagacagtcaccgcctgggacacggccattgccccc
ctggacggcgaggagctcattgtggaggtcctcgaagatgtccccctgaccatgcacaat
tttgtacggaagacattcttcagcctggccttttgtgacttctgccttaagtttctgttc
catggcttccgctgccaaacctgtggatacaagttccaccagcattgttcctccaaggtc
cccacagtttgtgtcgacatgagtaccaatcgccgacagttctaccacagtgtccaggat
ttgtccggaggctccagacagcatgagactccctcgaaccgccccctgaatgagccgcta
acccctcagggtcccagctcctgcacccagcaccgcgaccctgagcacttccccttccct
gccccggccaatgcccccctgcagcgcatccgctccacgtccacccccaacgtccacatg
gtcagcaccaccgcccccatggactccggcctggtccagctcactgcccagagtttcaac
actgatgctgctggtaatagaggtggtggcgacggagccccccgggggagccccagccca
gccagcgtgtcctcggggaggaagtccccacattccaagtcgccatctgagcagcgggag
cggaagtccttggccgacgacaagaagaaagtgaagaatctggggtaccgggactcgggc
tattactgggaggtgccccccagtgaggtgcagctgctgaagaggatcgggacgggctcg
tttggcaccgtgtttcgcgggcggtggcatggcgatgtggccgtgaaggtgctcaaggtg
gcccagcccacagccgagcaggcccaggccttcaagaacgagatgcaagtgctcaggaag
acgcggcacgtcaacatcttgctgttcatgggcttcatgacccggcccggctttgccatc
atcacacagtggtgcgagggctccagtctgtaccaccacctgcacgtggccgacacacgc
ttcgacatggtccagctcatcgatgtggcccggcagactgcccagggcatggactacctc
catgccaagaacatcattcaccgagatctcaagtctaacaacatcttcctacacgagggc
ctcacggtgaagatcggggacttcggcctggccacagtgaagacgcggtggagcggggcc
cagcccttggagcagccctcgggctccgtgctgtggatggcggctgaggtgatccggatg
caggacccgaacccctacagcttccagtctgacgtctatgcctatggggtggtgctctac
gagctcatgaccggctcgctgccttacagccacattggcagccgtgaccagattatcttc
atggtgggccgtggctatctgtccccggacctcagcaaaatctccagcaactgccccaag
gccatgcggcgcctgctgtctgactgcctcaagttccagcgggaggagcgacccctcttc
ccccagatcctggccacgattgagctgctgcagcggtcactccccaagattgagcggagt
gcctcggaaccctccttgcaccgaacccaggctgatgagttgcctgcctgcctactcagc
gcagcccgccttgtgccttag

DBGET integrated database retrieval system