KEGG   Sus scrofa (pig): 100514952Help
Entry
100514952         CDS       T01009                                 

Gene name
GALNT17
Definition
(RefSeq) LOW QUALITY PROTEIN: putative polypeptide N-acetylgalactosaminyltransferase-like protein 3
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00512  Mucin type O-glycan biosynthesis
ssc01100  Metabolic pathways
Module
ssc_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    100514952 (GALNT17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ssc01003]
    100514952 (GALNT17)
Enzymes [BR:ssc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     100514952 (GALNT17)
Glycosyltransferases [BR:ssc01003]
 O-Glycan biosynthesis
  Mucin-type
   100514952 (GALNT17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin RicinB_lectin_2
Motif
Other DBs
NCBI-GeneID: 100514952
NCBI-ProteinID: XP_020942008
LinkDB All DBs
Position
3
AA seq 598 aa AA seqDB search
MASLRRVKVLLVLNLIAVAGFVLFLAKCRPISVRSGDAFHEIRPRAEAANLSAHSASPIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKELKYAKELPQISIIFIFVNEALSVILRSVHSAVNHTP
THLLKEIILVDDNSDEEELKAPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKVATGQ
VTGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDTFEVQRYENSAHGYSWELW
CMYIXPPKDWWDAGDPSSPRRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENPGIDIGDVSERRALRKSLKCKNFQWYLDHVYPEMRRYNNTIAYGELRNNKAKDVCLD
QGPLENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNSKSRLPQLLD
CDKVKSSLYKRWNFIQNGAIMNKGTGRCLEVENRGLAGIDLILRSCTGQRWTIKNSIK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactgagaagagtcaaagtgctgctggtgttgaacttgatagcagtggccggc
ttcgtgctcttcctggctaagtgccggcccatatcggtgcgcagcggagacgccttccac
gaaattcggccgcgcgccgaggcggccaaccttagtgcgcacagcgcgagccccatccag
gatgcggtcctgaagcgcctctcgctgctcgaggacattgtctaccggcaactgaatggt
ttatccaaatcccttgggctcattgaaggttatggtggacggggcaaagggggccttcct
gctaccctttccccggctgaagaagagaaagccaagggaccccatgagaagtatggctac
aattcctacctcagtgaaaaaatttcactggatcgttccattccggattaccgtcccacc
aagtgtaaggagctgaaatacgccaaggagttgccccagatatccatcatatttatcttc
gtgaacgaggccctgtccgtgatcctgcggtccgttcatagcgccgtcaaccacacgcca
acccacctgttgaaggaaatcattctagtggatgacaacagcgacgaagaggagctgaag
gcccccttggaggagtacgtccacaaacgctaccccgggctggtgaaggtggtgagaaat
caaaagagagagggcctgatccgagctcgcatcgagggctggaaggtggccaccggccag
gtcaccggcttctttgatgcccacgtggagttcaccgctggctgggccgagcccgttctc
tccaggatccaggagaaccggaagcgggtgatcctcccttccatcgacaacatcaaacag
gacaccttcgaggtgcagcggtatgagaactcggcccatgggtacagctgggagctgtgg
tgcatgtacatcnagccccccaaagactggtgggacgccggagacccttcctccccccgc
aggaccccagccatgattggctgctcgtttgtggtcaacaggaagttctttggcgaaatt
ggtcttctggaccctgggatggatgtgtatggaggagaaaatatcgaactcggaatcaag
gtatggctctgcgggggcagcatggaggtcctgccttgctcacgggtggcccacattgag
cggaagaagaagccatacaacagcaacattggcttctacaccaagaggaatgccctccgg
gttgctgaggtctggatggacgattacaagtctcacgtgtacatagcgtggaatttgccc
ctggagaatccaggaattgacattggcgatgtctccgagagaagagccttaaggaaaagt
ttaaagtgtaagaatttccagtggtacctggaccacgtctacccagaaatgagaagatac
aataacaccattgcctacggggagcttcgcaacaacaaggcaaaagacgtctgcttggac
caggggccgctggagaaccacacagcaatactgtacccgtgccacggctggggaccccag
ctggcccgctacaccaaggagggcttcctgcatctgggggccctggggaccaccacgctc
ctcccggacacccgctgcctggtggacaactccaagagtcggctgccccagcttctggac
tgcgacaaggtcaagagcagcctgtacaagcgctggaacttcatccagaatggcgccatc
atgaacaagggcacagggcgctgcctggaggtggagaaccgcggcctggctggcatcgac
ctcatcctgcgcagctgcacgggacagaggtggacgattaagaactccatcaagtag

DBGET integrated database retrieval system