KEGG   Sus scrofa (pig): 100515021
Entry
100515021         CDS       T01009                                 

Gene name
EML4
Definition
(RefSeq) echinoderm microtubule-associated protein-like 4 isoform X3
  KO
K15420  echinoderm microtubule-associated protein-like 4
Organism
ssc  Sus scrofa (pig)
Pathway
ssc05200  Pathways in cancer
ssc05223  Non-small cell lung cancer
ssc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100515021 (EML4)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100515021 (EML4)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    100515021 (EML4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ssc04812]
    100515021 (EML4)
Cytoskeleton proteins [BR:ssc04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EMAP
     100515021 (EML4)
SSDB
Motif
Pfam: HELP WD40 ANAPC4_WD40 Ribosomal_S7 SlyX
Other DBs
NCBI-GeneID: 100515021
NCBI-ProteinID: XP_003125244
Ensembl: ENSSSCG00000008467
UniProt: A0A287AHD3
LinkDB
Position
3
AA seq 992 aa
MDGFAGSLDDSISAASTSDVQDRLSALELRVQQQEDEITVLKAALADVLRRLAISEDHVA
SVKKSVPSKGQPGLREAISMSCITNGSGSNRKPSHTSSVSIARKETLSSAAKSGTEKKKE
KPQGQREKKEESHSNDQSPQIRASPSPQPSSQPLQIHRQTQESKNSTPTKSIKRPATAEK
SHNSWENSDDSRNKLFKAVSTSKLISKVIKNTDKHKDVIINQAKMSTREKNSQEGEYIKM
FMRGRPITMFIPSDVDNYDDIRTELPPEKLKLEWVYGYRGKDCRANVYLLPTGEIVYFIA
SVVVLFNYEERTQRHYLGHTDCVKCLAIHPDKIRIATGQIAGVDKDGRPLQPHVRVWDSV
SLSTLQIIGLGTFERGVGCLDFSKADSGVHLCVIDDSNEHMLTVWDWQKKSKGAEIKTTN
EVVLAVEFHPTDANTIITCGKSHIFFWTWSGNSLTRKQGVFGKYEKPKFVQCLAFLGNGD
VLTGDSGGIILIWNKTTVEPTPGKGPKGVYQISKQIKAHDGSVFTFCHMRNGMLLTGGGK
DRKIILWDHDLNPEREIEVPDQYGTIRAVAEGKADQFLVGTSRNFILRGTFNDGFQIEVQ
GHTDELWGLATHPFKDLLLTCAQDRQVCMWNSAEHKLEWTRLVDEPGHCADFHPSGTVVA
IGTHSGRWFVLDAETRDLVSIHTDGNEQLSVMRYSVDGTLLAVGSHDNFIYLYVVSENGR
KYSRHGKCTGHSSYITHLDWSPENKYIMSNSGDYEILYWDIKENCKLIRNRSHCKDIDWT
TYTCVLGFQVFGVWPEGSDGTDINALVRSHNRRVIAVADDFCKVHLFQYPCSKAKAPSHK
YSAHSSHVTNVSFTHNDSHLISTGGKDMSIIQWKLVEKLPLPQNEIVADTTLTKAPISSI
ESIMQSDTPTPPPSQPSNETAEEESRVSSSPTLLENSLEQTVEPSEGRSEEQSEGGSEEL
GEPVCEEPASEISEEHGEAALPEDQQDPSPLS
NT seq 2979 nt   +upstreamnt  +downstreamnt
atggacggtttcgccggcagcctcgatgatagtatttctgctgcaagtacttctgatgtt
caagatcgcctctcagctcttgagttaagagttcaacaacaagaagatgaaatcactgtg
ctaaaggcagctttggctgatgttttaaggcgtcttgcaatctctgaagatcatgtagcc
tcagtgaagaaatcagtcccaagtaaaggccagccaggccttcgagaagctatttccatg
tcctgtataaccaatgggagtggttcaaacagaaaaccaagtcacaccagctctgtctca
atcgcaagaaaagaaactctttcatctgctgctaaaagtggtacagaaaaaaagaaagaa
aaaccacaaggacagagagaaaaaaaagaggaatctcactctaatgatcaaagtccacaa
attcgagcatcaccttctccccaaccctcttcacagcctctccaaatacacagacaaact
caagaaagcaagaattctactcccaccaaaagcataaaacgaccagcaacagctgaaaag
tcacataattcatgggaaaattcagatgatagccgtaacaaattattcaaggcagtttca
acatcaaaattaatatccaaagttataaaaaatacagacaagcataaagatgtcatcatc
aaccaagcaaaaatgtcaacccgtgaaaaaaacagtcaagaaggagaatatattaaaatg
tttatgcgaggtcggccaatcacaatgttcattccttctgatgttgacaactatgacgac
atcagaacagaactgcctcctgagaagctcaaactggagtgggtatatggttatcgtgga
aaggactgtcgggctaatgtttaccttcttcctactggggaaattgtttatttcatagca
tcagtagtagtactatttaattatgaggagagaactcaacgacactacctgggtcataca
gactgtgtgaaatgccttgctatacatcctgacaaaattaggattgcaactggacagata
gctggagtggataaggatggaaggcctttgcaaccccatgttagagtgtgggattcagtt
agtctatctacactgcagattattggacttggaacttttgagcgtggagttggatgcctg
gatttttcaaaagcagattcaggtgttcatttatgtgttatcgatgactccaatgagcac
atgcttactgtatgggattggcagaaaaaatcaaaaggagcagaaataaagacaacaaat
gaagtcgttttggctgtggaattccatccaacagatgcaaataccataataacatgtggt
aaatctcatatttttttctggacctggagtggcaattcactaacaagaaaacagggagtt
tttgggaaatatgaaaaaccaaaatttgtgcagtgtttagcattcttggggaatggagat
gtgcttactggagactcaggtggaatcatacttatatggaacaaaactactgtagaaccc
acacctgggaaagggccaaaaggtgtttatcagatcagcaaacagattaaagctcatgat
ggcagtgtgttcacattctgtcacatgagaaatgggatgttattaactggaggcgggaaa
gatagaaaaataattctatgggatcatgatctgaatcctgaaagagaaatagaggttcct
gatcagtatggaacaatcagagctgtagcggaaggaaaagcagatcaattcttagtcggc
acatcacgaaactttattttacggggaacattcaacgatggcttccaaatagaagtacag
ggtcacacagatgagctttggggtcttgccacacatcccttcaaagatttgctcttgact
tgtgctcaggatagacaggtgtgcatgtggaactcggcagaacacaagctggaatggacc
aggctcgtagatgaaccaggacactgtgcagattttcatccaagtggcacagtggtggcc
ataggaacgcactcaggcaggtggtttgttctggatgcagaaaccagagatctagtttct
atccacacagatgggaatgaacagctctctgtgatgcgctactcagtagatggcaccctc
ctggccgtaggatctcacgacaactttatttacctctatgtggtctctgaaaatggaaga
aaatatagcaggcatggaaagtgcactggacattccagctatatcacacaccttgactgg
tccccagaaaacaagtatataatgtctaactcgggagactatgagatactgtactgggac
attaaagagaactgcaaactaatcaggaatcgatcacactgtaaggacatcgattggaca
acatatacctgtgtgctaggctttcaagtcttcggtgtctggccagaaggatccgatggg
acagatatcaatgcgctcgtgcgctcccacaatagaagagtgatcgctgtggctgatgac
ttttgcaaagtccatctgtttcagtatccctgctccaaagcgaaggctcccagtcacaag
tacagtgcccacagcagccatgtcaccaatgtcagttttactcacaatgacagtcacctg
atttcaactggtggaaaagacatgagcatcattcagtggaaacttgtggaaaagttacct
ctgcctcaaaatgagattgtagcggatactacgctaaccaaagcccccatctcttccatt
gagagcatcatgcagtccgatactcccacgccacctccttcccagccctcaaatgagaca
gctgaagaagaaagtagggtaagcagttctcccacacttctggagaacagcctggaacag
actgtggagcccagcgaaggccgcagcgaggagcagagcgaggggggcagtgaagagctg
ggcgagcctgtctgtgaagagccagccagtgagataagcgaggagcacggcgaagccgct
cttcccgaggaccagcaagacccctcacccctgtcctaa

KEGG   Sus scrofa (pig): 100518423
Entry
100518423         CDS       T01009                                 

Gene name
ALK
Definition
(RefSeq) ALK tyrosine kinase receptor
  KO
K05119  anaplastic lymphoma kinase [EC:2.7.10.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc05200  Pathways in cancer
ssc05223  Non-small cell lung cancer
ssc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100518423 (ALK)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100518423 (ALK)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    100518423 (ALK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100518423 (ALK)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ssc04090]
    100518423 (ALK)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100518423 (ALK)
Protein kinases [BR:ssc01001]
 Receptor tyrosine kinases (RTK)
  ALK family
   100518423 (ALK)
CD molecules [BR:ssc04090]
 Proteins
  100518423 (ALK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr MAM Pkinase Gly_rich Nup96 FXa_inhibition
Other DBs
NCBI-GeneID: 100518423
NCBI-ProteinID: XP_020943328
Ensembl: ENSSSCG00000008533
Vega: OTTSUSG00000002319
LinkDB
Position
3
AA seq 1620 aa
MGAIGLLWPLLLLLLLAAASSSGTGTETGQRVVSPAMGLALQPREPLSYSRLQRKSLAVD
FVVPSLFRVYARDLLLPPLSPSEPRTGRLEARGSLVLDCAPLLRLVGPSPEVSWTAGASS
PAPAQARTLSRVLKGGSIRKLRRAKQLVLELGEEAILEGCVGPPEETTVGLLQFNLSELF
SWWIRHGEGRLRIRLMPEKKASEVGREGRLSAAIRASQPRLLFQILETRTGHISLESPTN
LPSLPPDSFAWNLTWIMKDSFPFLSHRSRYGLECSFDFPCELEYSPPLHNRGNQSWSWRR
VPSEEASQMDLLDGPETEHSKEMPRGAFLLLNTSANSKHTILSPWMRSSSEHCRLAVSVH
RHLQPSGRYVAQLLPHNEAGREIVLVPTPGKHGWTVLQGRIGRPENPFRVALEYISSGNR
SLSAVDFFALKNCSEGTSLGSKMALQSSFTCWNGTVLQLGQACDFHQDCAQAEDEGQLCS
KLPAGFYCNFENGFCGWTQSSLSRHMPQWQVKALQDAQTQDHQGHALVLSTTDAPTSASA
TVTSAAFPPPMKSSPCELRMSWLIRGVLQGNVSLVLVENKTGKEQSRMIWQVATIEGLNL
WQWTVLPLLDVADRFWLQIVAWWGQGSRATVAFDNISVSLDCYLTISGEDKLPQNTAPKS
RNLFERNPNKEPKAWENTPGETPIFDPTVHWLFTTCGASGPHGPTQAQCNNAYRNSNLSV
VVGSEGPLKGIQTWKVPATDTYSISGYGAAGGKGGKNTMMRSHGVSVLGIFNLEKDDTLY
ILVGQQGEDACPSTNRLIQKVCIGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKD
GVPVPLIIAAGGGGRAYGAKTDTFHPERLENNSSVLGLNGNSGAAGGGGGWNDNTSLLWS
GKSLLEGATGGHSCPQAMKKWGWETRGGFGGGGGGCSSGGGGGGYIGGNAASNNDPEMDG
EDGVSFINPLGILYTPALKVMEGHGEVNIKHYLNCSHCEVDECHMDPESHKVICFCDHGT
VLAEDGVSCIVSPTPEPQLPLSLILSVVTSALVAALVLAFSGVMIVYRRKHQELQAMQME
LQSPEYKLSKLRTSTIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYE
GQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQALPR
FILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAA
RNCLLTCPGPGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDT
WSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPED
RPNFAIILERIEYCTQDPDVINTALPVEYGPLVEEEEKVPMRPKDPEGIPPLLVAAPQPR
REEGPEPAAPPPPPAASSGKAGKKAAAAELAVRGPRGAAADGGHVNMAFAPSSAPSELHK
VQGSRNKPTSLWNPTYGSWFTEKPTPKNSPPAKREPPGRGSLGREGSCGGPSAAAPGRLP
GAALLLEPSSLTADVKDVPLFRLRHFPCGTVHYGYQQQGFPPEAAPGRSPDPALKGQAAP
NT seq 4863 nt   +upstreamnt  +downstreamnt
atgggagccatagggcttctatggccgctgctgctgctgctgcttttagcggcagcctcg
agttccgggactgggacagaaaccggccagcgcgtggtctcaccggccatggggctggca
ctgcaaccccgggagccgcttagctactcgcgcttgcagagaaagagcctggcggtggac
tttgtggtgccctcgctctttcgcgtctatgcccgggacctgctgctgccgccgctgtcc
ccctcggaaccgaggactggccggctggaggcacgcggctctctggttctcgactgcgcc
ccactgcttaggctggtggggccttcacccgaggtctcctggacagcaggtgccagctct
cccgccccggcccaggcacggacgctgtccagggtgctgaagggaggctctattcgcaag
ctccggcgcgccaagcagctggtgctggagctcggagaggaagcgatccttgagggctgt
gtagggccccccgaggagacgacggtggggctgctccagttcaacctcagtgagctgttc
agctggtggattcgccacggcgaagggcggctgaggatccgcctgatgcccgagaagaag
gcgtcggaagtgggcagagagggaaggctgtccgctgcgatccgcgcctcacagccccgc
cttctcttccagatcttggagaccaggaccggtcacatctccttggagtcaccgacaaac
ctaccttcccttcctcctgattcttttgcatggaatctgacctggataatgaaagattcc
ttccctttcctgtctcatcgcagccgatatggtctggaatgcagctttgacttcccctgc
gagctggagtattcccctccactgcataaccgagggaaccagagctggtcctggcgccgc
gtcccctctgaggaggcctcccagatggacctgttggatgggcccgagacagagcattcc
aaggagatgcccagaggcgccttcctcctcctcaacacctcggccaactccaagcacacc
atcctgagcccgtggatgaggagcagcagtgagcactgcaggctggccgtctcggtgcac
aggcacttgcagccctctgggaggtacgtcgcccagctgctgccccacaacgaagctgga
agagagattgtcctggtacccactccagggaagcatggttggactgtgctgcagggaaga
attgggcgtccagagaacccattccgagtggccttggaatacatttcgagtggaaaccga
agcttgtctgcagtggacttctttgccctgaagaactgcagtgaaggaacgtccctgggc
tccaagatggccttgcagagttccttcacttgctggaatgggacagtcctccagctcggg
caggcctgcgacttccatcaggactgtgcccaggcagaagacgagggccaactgtgcagt
aaactcccggctggtttttactgcaacttcgagaatggcttctgtggctggacccaaagc
tcactgtcacgccacatgccccagtggcaggtcaaagccttacaggatgcccagacccag
gaccaccaaggccacgccctggtgctcagcaccactgacgcccccacttctgcgagtgcc
acggtgaccagcgctgcatttcccccgccgatgaagagctctccgtgtgagctccgaatg
tcctggctcatccgtggagtgttgcagggaaacgtctccctggtgctggtggagaacaaa
accgggaaggagcaaagcagaatgatctggcaggtcgccaccatcgaaggcttgaacctg
tggcagtggacggtgctccctctcctcgatgtggccgacaggttctggctgcagattgtc
gcctggtggggacaaggatccagagccaccgtggctttcgacaatatctccgtcagcctg
gactgctacctcaccatcagtggggaggacaagctgccacagaacacggcacctaaatca
agaaatctgtttgagagaaacccaaacaaggagccgaaagcctgggaaaatacaccggga
gagacccccatctttgaccctacagttcactggctgttcaccacgtgcggggccagtggg
ccccacggccccacgcaggcccagtgcaacaacgcctaccggaactccaacctgagcgtg
gtggtggggagcgagggccccctgaagggcatccagacctggaaggtgccagccaccgac
acctacagcatctcaggctacggagccgccggcgggaaaggcgggaagaacaccatgatg
cggtcccacggcgtgtctgtgctgggcatcttcaacctggagaaggacgacaccctgtac
atcctggtcgggcagcagggggaggacgcctgccccagtaccaaccgattaatccagaaa
gtctgcattggcgagaacaacgtgatcgaagaagagatccgcgtgaacagaagcgtgcac
gagtgggccggagggggcggaggagggggcggagccacctacgtgtttaagatgaaggat
ggcgtgccagtgcccctgatcattgcagctggcggtggtggcagggcctacggggccaag
acagacacgttccaccctgagaggctggagaataactcctcagttctagggctgaacggc
aattctggagccgcaggtggcggaggtggctggaatgataacacttccttgctctggtct
ggaaaatctttgctggagggcgccaccggaggacattcctgcccccaggccatgaagaag
tgggggtgggagacaagagggggtttcggagggggtggcggggggtgctcctcaggtgga
ggaggcggaggatatataggtggcaatgcggcctcaaacaatgaccccgagatggacggg
gaggatggggtttctttcatcaacccactgggcatcctgtacaccccggctctaaaagtg
atggagggccatggggaagtgaatattaagcattacctaaactgcagccactgtgaggtc
gatgagtgccacatggaccccgagagccacaaggtcatctgcttctgtgaccatgggaca
gtgctggctgaggacggtgtctcctgcatcgtgtcgcccaccccggagccccagctgccg
ctctcgctgattctctccgttgtgacctccgccctcgtggccgccctggtcctggccttc
tccggcgtcatgatcgtgtaccgccggaagcaccaggagctgcaagccatgcagatggag
ctgcagagccccgagtacaagctaagcaagctccgtacctcgaccatcatgaccgactac
aaccccaactactgctttgccggcaagacttcctccatcagtgacctgaaggaggtgcct
cggaaaaacatcaccctcatccggggtctgggccatggcgcgtttggggaggtgtatgaa
ggtcaggtgtctggaatgcccaatgacccgagccccctgcaagtggccgtaaagacgctg
cctgaggtttgttccgagcaggacgagctggatttcctcatggaagccctgatcatcagc
aaattcaaccaccagaacatcgtgcgctgtatcggggtgagtctgcaagccctgccccga
tttatcctgctggagctcatggcaggaggagacctcaagtccttcctccgggagacgcgc
cctcgcccgagtcagccctcctcgctggccatgctggacctcctgcacgtggctcgggac
attgcctgtggctgtcagtatttagaggaaaatcatttcatccaccgggacattgctgcc
aggaactgcctcttgacctgtccaggccctggcagagtggccaagattggagacttcggg
atggcccgcgacatctaccgagcgagctactaccgaaagggaggctgtgcgatgctgccg
gtcaaatggatgcccccggaggccttcatggagggaatatttacttctaaaacagacacg
tggtccttcggagtgctgctgtgggagatcttctctctcggatacatgccataccctagc
aaaagcaaccaggaagttctggagtttgtcaccagtggaggacggatggacccacccaag
aactgccccgggcctgtataccggataatgacccagtgctggcaacatcagcctgaagac
aggcccaacttcgccataattttggaaaggattgagtactgcacccaggatccagatgtg
atcaacaccgctttgcccgtagagtacggccccctcgtggaagaggaagagaaggtgccc
atgaggcccaaggaccccgagggcatcccccctctcctggtggcggctccccagccccgg
cgggaggagggccccgagccagccgcgccgccccctccgcccgccgcttcctcgggcaaa
gccgggaagaaggccgcggccgcggagctcgccgtccggggccccaggggcgcggccgcg
gacgggggacacgttaacatggccttcgctccgtccagcgcgccctcggagctgcacaaa
gtccagggctcccgaaacaagcccaccagcctctggaacccgacctacggctcctggttc
acggagaaacccaccccaaagaacagccccccggccaagcgcgagccgcccggcaggggc
agcctgggccgcgagggcagctgcggcggcccgtccgccgcggcccccggccggctcccc
ggcgccgctctgctcctcgaaccttcctcgctgacggccgacgtgaaggacgtgcctctg
ttccggctgcgtcacttcccctgcggcaccgtccactacggctaccagcagcagggcttc
cccccggaggccgcgccgggccgctccccggaccccgcgctcaaaggccaggccgcgccc
tga

DBGET integrated database retrieval system