KEGG   Sus scrofa (pig): 100515110
Entry
100515110         CDS       T01009                                 

Gene name
SMO
Definition
(RefSeq) smoothened homolog
  KO
K06226  smoothened
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04340  Hedgehog signaling pathway
ssc04360  Axon guidance
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100515110 (SMO)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100515110 (SMO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100515110 (SMO)
   05205 Proteoglycans in cancer
    100515110 (SMO)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100515110 (SMO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ssc04030]
    100515110 (SMO)
G protein-coupled receptors [BR:ssc04030]
 Frizzled / Smoothened family
  100515110 (SMO)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 100515110
NCBI-ProteinID: XP_003134728
Ensembl: ENSSSCG00000016569
UniProt: F1SMQ3
LinkDB
Position
18
AA seq 783 aa
MAAARLARGPELLLLGLLLLLVLLGDPGWGAALSGNATWPGPRSAGGSARRSAAVTGPPP
PLSHCGRAAPCEPLRYNVCLGSALPYGATSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCW
AVIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCAIVERERGWPDFLRCTPDHFPEGCP
NEVQNIKFNSSGQCEAPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGA
VTGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADG
TMRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSY
FHLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLVVGGYFL
IRGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAE
WERSFRDYVLCQANVTIGLPTKKPIPDCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTK
ATLLIWRRTWCRLTGQSDDEPKRIKKSKMIAKAFSKRRELLQNPGQELSFSMHTVSHDGP
VAGLAFDLNEPSADVSSAWAQHVTKMVARRGAILPQDVSVTPVATPVPPEEKANLWLVEA
EISPELEKRLGRRKKRRKRKKEVCPLVPPPEPHHPAPGPAPTSSAVPRLPQLPRQKCLVA
AAAWGAGESCRQGTWTLVSHPFCPEPSAPAPMAWVQGRRPGLGPIHSRTNLMEAELMDAD
SDF
NT seq 2352 nt   +upstreamnt  +downstreamnt
atggccgctgcccgcctcgcacgggggccggagctcctgctcctggggctgctgctgctg
ctggtgctgctgggggacccgggctggggggcggccttgagcgggaacgcgacctggcct
gggccgcggagcgcgggcgggagcgcgagacggagcgcggcggtgaccggccctccgccg
ccgctgagccactgcggccgggccgccccctgcgagccgctgcgctacaacgtgtgcctg
ggctcggcgctgccctacggggccacctccacgctgctggccggggactcggactcccag
gaggaagcgcacggcaagctggtgctctggtcgggcctccggaacgccccccgctgctgg
gcggtgatccagcctctgctgtgtgccgtgtacatgcccaagtgcgagaacgaccgggtg
gagctgcccagccgcaccctctgccaggccacccgaggcccctgtgccatcgtggagagg
gagcggggctggcccgacttcctgcgctgcacccccgaccacttccctgagggctgcccg
aatgaggtgcagaacatcaagttcaacagttcaggtcaatgcgaggcccccttggttcgg
accgacaaccccaagagctggtacgaggacgtggagggctgcgggatccagtgccagaac
ccgctcttcaccgaggccgagcaccaggacatgcacagctacatcgcggccttcggggcc
gtcacgggcctctgcacgctcttcaccctggccacctttgtggctgactggcggaattcc
aatcgctaccctgctgtcattctcttctacgtcaatgcctgtttcttcgtgggcagcatt
ggctggctggcccagttcatggacggtgcccgccgggagatcgtctgccgcgctgatggc
accatgaggcttggggagcccacctctaacgagacactgtcctgcgtcatcatctttgtc
atcgtgtactacgccctgatggctggtgtcgtctggtttgtggtcctcacctatgcttgg
cacacctccttcaaagccctggggaccacctaccagcctctctcgggcaagacctcctac
ttccacctgctcacgtggtcactcccctttgtcctcactgtggccatccttgctgtggcc
caggtggatggggactccgtgagtggcatctgttttgtgggctataagaactaccgatac
cgtgccggctttgtgctggccccaatcggcctggtgctggttgtgggcggttacttcctc
atccgaggggtcatgaccctgttctctatcaagagcaaccaccctgggctgctgagcgag
aaggcagccagcaagatcaacgagaccatgctgcgcctgggcatttttggcttcctggcc
tttggctttgtgctcatcactttcagctgccacttctatgacttcttcaaccaggctgag
tgggagcgcagcttccgggactacgtgctgtgccaggccaatgtgaccatcgggctgccc
accaagaagcccatccctgactgtgagatcaagaatcgccctagcctcctggtggagaag
atcaacctatttgccatgtttggaaccggcattgccatgagcacctgggtctggaccaag
gccacactgctcatctggagacgcacctggtgcaggttgaccgggcagagtgatgacgag
cccaaacggataaagaagagcaagatgattgccaaggccttctccaagcggcgcgagctg
ctgcagaacccaggccaggagctctccttcagcatgcacaccgtctcccacgacgggcct
gtggcgggtttggcctttgacctcaacgagccctcggccgatgtgtcttctgcctgggcc
cagcatgtcaccaagatggtggcccggagaggagccatcctgccccaggatgtgtctgtc
acccccgtggcaactccagtgcccccggaagaaaaagccaacctctggctggttgaggca
gagatctccccggagctggagaagcgcctgggccggaggaagaagcggaggaagaggaag
aaggaggtgtgcccgctggtgccgcctcccgagccccaccacccggccccgggccctgcg
cccacctccagcgctgtccctcgactgccgcagctgccccggcagaagtgcctggtggcc
gcagcggcctggggagctggggaatcctgccgacagggaacctggaccctggtctcccac
cccttctgcccagagcccagcgccccagcccccatggcctgggtgcagggccgccggccg
gggctggggcccattcactcccgcaccaacctgatggaggcagaactcatggacgcagac
tcggacttctga

DBGET integrated database retrieval system