KEGG   Sus scrofa (pig): 100515113Help
Entry
100515113         CDS       T01009                                 

Gene name
POLM
Definition
(RefSeq) DNA-directed DNA/RNA polymerase mu isoform X1
  KO
K03513  DNA polymerase mu [EC:2.7.7.7]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    100515113 (POLM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ssc03400]
    100515113 (POLM)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     100515113 (POLM)
DNA repair and recombination proteins [BR:ssc03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    X-family DNA polymerases
     100515113 (POLM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_lambd_f DNA_pol_B_thumb DNA_pol_B_palm HHH_8 NTP_transf_2 Cdd1 Phage_Nu1 SecA_SW
Motif
Other DBs
NCBI-GeneID: 100515113
NCBI-ProteinID: XP_003134936
Ensembl: ENSSSCG00000016755
UniProt: F1SSF6
LinkDB All DBs
Position
18
AA seq 540 aa AA seqDB search
MGRGLPPREEPGATSLFSRLPPLASAFRRLSFCSPAGFSVSRGAEARAGMLPRRRRARVG
PPEAAPSSAARFPGVAIYLAEPRMGRSRRAFLTRLALSKGFRVLDAYSPEVTHVVMEGTS
AEEAISWQEHRTPSLPPGCSHPALLDVSWFTESMAAGQPVPVERRHRLEVAVPREELPSP
VWMLPYACQRPTPLTHHNASLSEALETLAEAADFDGSKGRHVSFCRAASVLKALPSPVTA
LSQLQGLPHFGEHSRRVIQELLEHGVCEEVERVRLSERYQTMKLFTQIFGVGVRTADQWY
QEGLRTLDDLREQPQRLTKQQKAGLQHYQDLSALILRSEVEALQQVVEAAVGQVLPGATV
TLAGGFRRGKLQGHDVDFLITHPQEGLEAGLLPSVICCLEKQGLVLYHQHQRGQQGDPTH
LAQKPHAMDAFEMSLCIFRLPRPPEAAVGGPREPCPPWKAVRVDLVVTPISQFPFALLGW
TGSKHFERELRRFSRKERGLWLNSHGLFDSEQKMPFHVASEEDIFGLLGLEYLPPEQRNA
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggggcggggcttgcctccccgagaggagccgggcgccacttcgctcttcagccggctt
ccgccgcttgcttccgccttccgccggctctccttctgctctcctgccggcttctccgtg
tcgcggggcgccgaggccagggccgggatgctccccagacggcggcgagcgcgggtcggg
ccgcctgaggccgccccctcctccgccgcgcgcttccccggggtcgcgatctacttggcc
gagccacgcatgggccgcagccgccgggccttcctcacacgcctggcgctctccaagggc
ttccgagtcctggacgcctacagccccgaggtgacacacgtggtgatggaggggacctca
gcagaggaggccatctcctggcaggagcacaggacgccgtcccttcccccgggttgcagc
cacccggcgctgttagacgtaagctggttcacggagagcatggcggctggccagcctgtc
cctgtggagcgccggcaccgcctggaggtggctgtgcccagggaggagctgccaagtcca
gtgtggatgctgccctatgcctgccagcgtcccacacccctcacgcaccacaatgccagc
ctctcggaggctctggagacgctggcggaggcagcagacttcgacggcagtaagggccgc
cacgtctccttctgcagagcagcctcggtgctcaaggcccttcccagccccgtcacggcc
ctgagccagctgcaggggctgccccacttcggagagcactcccgcagggtcatccaggag
ctgctggaacacggagtgtgcgaggaggtggagagagtccggctctccgagaggtaccag
accatgaagctcttcacccagatcttcggggtcggggtacggactgccgatcagtggtac
caggaggggctgcggacgctggacgacctccgagagcagccccagagactgaccaagcag
cagaaagcaggcctgcagcactaccaggacctgagcgccctgatcctgcggtcagaagtg
gaggccctgcagcaggtggtggaggcagctgtggggcaggtcctgccgggggccaccgta
acgctggccggcggcttccggagggggaagttgcagggccacgacgtggacttcctcatc
acccacccccaggagggcctggaggcagggctgctgcccagcgtgatatgctgtctggag
aagcagggcctcgtcctgtaccaccagcaccagcgcggccaacagggagaccccacccac
ctggcccagaagccccacgccatggatgcctttgagatgagtctctgcattttccgcctg
ccacgccccccagaggctgccgtaggggggccccgggagccctgccccccctggaaggct
gtgcgagtggacctggtggtcacccccatcagccagttccccttcgccctgctcggctgg
actggctccaagcatttcgagcgggagctgcgccgcttcagccggaaggagagggggctc
tggctgaacagccatggtctgtttgactcggagcagaaaatgcctttccacgtggcttca
gaggaggacatcttcggactcctgggcctggagtaccttcccccagagcagagaaatgcc
tga

DBGET integrated database retrieval system