KEGG   Sus scrofa (pig): 100515777
Entry
100515777         CDS       T01009                                 

Gene name
LRP6
Definition
(RefSeq) LOW QUALITY PROTEIN: low-density lipoprotein receptor-related protein 6
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04150  mTOR signaling pathway
ssc04310  Wnt signaling pathway
ssc04928  Parathyroid hormone synthesis, secretion and action
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05200  Pathways in cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100515777 (LRP6)
   04150 mTOR signaling pathway
    100515777 (LRP6)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100515777 (LRP6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100515777 (LRP6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100515777 (LRP6)
   05226 Gastric cancer
    100515777 (LRP6)
   05224 Breast cancer
    100515777 (LRP6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100515777 (LRP6)
   05022 Pathways of neurodegeneration - multiple diseases
    100515777 (LRP6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssc04131]
    100515777 (LRP6)
Membrane trafficking [BR:ssc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    100515777 (LRP6)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition Ldl_recept_a DUF5050 SGL cEGF
Other DBs
NCBI-GeneID: 100515777
NCBI-ProteinID: XP_020948003
Ensembl: ENSSSCG00000000625
LinkDB
Position
5
AA seq 1618 aa
MREGKMGAVLRSLLACSFCVLLRAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAA
VDFVFGHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSE
TNRIEVSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFI
IINTEIYWPNGLTLDYEERKLYWADXKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFED
TLYWTDWNTHSILACNKYTGEGLREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSH
LCLMSPVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQ
LEDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVAR
NLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAA
LDGSDRVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHI
FGFTLLGDYVYWTDWQRRSIERVHKRSAEREIIIDQLPDLMGLKATNVHRIIGSNPCAEE
NGGCSHLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVA
IPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWL
GKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDR
AAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHP
FGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECAS
SNGHCSHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSP
DIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPNQNLEIQ
PYDLSIDIYSRYIYWTCEATNVINVTRLDGRSIGVVLKGEQDRPRAIVVNPEKGYMYFTN
LQERSPKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGAN
RIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVK
ELNLQEYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELLCGEPPTCSPQQFT
CFTGEIDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQD
KSDEKNCEVLCLIDQFRCANGQCIGKHKKCDHNLDCSDKSDELDCYPTEEPAPQATNTVG
SVIGVIVTIFVSGTIYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPGSLSGS
LPGMSRGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATER
SHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKG
YTSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
NT seq 4857 nt   +upstreamnt  +downstreamnt
atgcgagaagggaagatgggggccgtcctgaggagcctcctggcctgcagtttctgcgtg
ctcctgagagcggcccctttgttgctttatgcaaacagacgggacctgcgactggttgat
gctacaaatggcaaagagaatgctacaattgtagttggaggcttggaggatgcagctgcg
gtggactttgtgtttggtcatggcttgatatactggagtgatgtcagcgaagaagctatt
aaacgaacagagttcaacaaaactgagagtgtacagaatgttgttgtttctggattattg
tcccctgatgggctggcatgtgattggcttggagaaaaattatactggacagattctgaa
actaatcgtattgaagtttctaatttagatggatctttacgcaaagttttattttggcaa
gagttggatcagcccagagctattgccttagatccttcgagtgggttcatgtactggaca
gactggggagaagtaccaaagatagaacgtgctggaatggatggttcaagtcgcttcatt
ataataaacactgaaatatactggccaaatggactgactttagattatgaggaacggaag
ctttattgggcagatngcaaacttaatttcatccacaaatcaaatctggatggaacaaat
cggcaggcggtggttaaaggttcccttccacatccttttgccttgacgttatttgaggac
acgttgtactggactgactggaatacacactctattttggcttgcaacaagtacactggc
gaaggtctgcgtgaaatccactctaacatcttctctcccatggatatacatgccttcagc
caacagagacagccaaatgctacaaatccatgcggaattgataatggtggctgttcccac
ttgtgtttgatgtctccagtcaagcctttttatcagtgtgcttgcccaactggggtcaaa
ctcctggaaaatggaaaaacctgcaaagatggtgccactgaattattgcttttagccaga
aggacagacttgagacgcatttctttggatacaccagatttcacagacattgtcctacag
ttagaagacatccgtcatgccatcgccatagattatgatcctgtggagggctatatctac
tggactgatgatgaagtgagggccatacgccgctcattcatagatggatctggcagtcag
tttgtggtcactgctcaaattgcgcatcctgatggtattgctgttgattgggttgcccga
aatctttattggacggacactggcactgatcgaatagaagtgacaaggctcaacgggacc
atgaggaagatcttgatttcagaggacttagaggaaccccgggctattgtattagatccg
atggttgggtacatgtattggactgactggggagaaatcccgaaaattgagcgagcagca
ctggatggttctgatcgagtagtgttggttaacacttctcttggttggccaaatggttta
gccttggattatgatgaaggcaaaatatactggggagatgccaaaacagacaaaattgag
gttatgaatactgatgggactgggagacgagtactagtagaagacaaaattcctcacata
tttgggtttactttgttgggtgactatgtttactggactgactggcagagacgcagcatc
gaaagagtacacaaacgaagtgctgagcgggagatcatcatagaccagctccctgacctc
atgggcctgaaggccacaaatgttcaccgaatcattggttccaacccctgtgctgaggag
aatgggggatgtagccatctctgcctctatagacctcagggcctccgctgtgcctgcccc
attggctttgaactcatcagtgacatgaagacctgcattgtcccagaggctttccttttg
ttttctcggagagcagatatcaggcgaatttccctggaaactaacaataataatgtagcc
attccactcactggtgtcaaagaagcttctgctttggattttgatgtgacagacaaccga
atttactggactgacatatcgctgaagaccatcagcagagcctttatgaatggcagtgca
ctggaacacgtggtagaatttggcctagattatccagaaggcatggcagtagactggctt
gggaagaacttgtactgggcagacacaggaacaaatcgaattgaagtgtcaaagttggat
gggcagcaccgacaagttttggtgtggaaagacctagatagtcccagagctcttgcgttg
gaccctgctgaaggatttatgtattggactgaatggggtgggaaacctaagattgacaga
gctgccatggatggaagtgaacgtaccactttagttccaaatgtcgggcgagcaaatggc
ctcactattgattatgctaaaaggaggctttattggacagatttggacaccaacctaata
gaatcttcaaatatgcttggactcaaccgtgaagttatagcagatgacttgcctcatcct
tttggcctaactcagtaccaagattacatctactggacggattggagccgacgcagcatt
gagcgtgccaacaaaaccagtggccaaaaccgcaccatcattcagggccatttggattat
gtgatggacatcctcgtgtttcactcctctcggcaggcagggtggaatgaatgtgcttcc
agcaatgggcactgctcccacctctgcttggccgtgccagttggaggttttgtttgcgga
tgccctgcccactactctctcaatgctgacaacaggacttgtagcgctccaactactttc
ctgctcttcagtcaaaagagtgccatcaaccgcatggtgatcgatgaacagcagagcccc
gacatcatccttcctatccacagccttcggaatgtccgggccatcgactacgaccccctg
gacaagcaactctattggattgactcaagacagaacatgatccgaaaagcccaagaagat
ggcagccagggctttactgtggtggtgagctcagttcccaatcagaacctagaaatacag
ccctatgacctcagcattgatatttatagccgctacatctattggacttgcgaggccacc
aatgtcattaacgtaacaagattagatgggagatcaattggagtggtgctaaaaggcgag
caagatagacctcgagccatcgtggtaaacccagagaaagggtatatgtattttaccaat
cttcaggaaagatctcccaaaattgaacgagctgctttagatggaacagaacgggaggtc
ctctttttcagtggcttaagtaaaccaattgctttagctcttgatagcagattgggcaaa
ctcttttgggctgattcagatctccggcggattgaaagcagtgatctctcaggtgccaat
cggatagtattagaagactccaatatcttgcagcctgtgggactgactgtgtttgaaaat
tggctatattggattgataaacagcagcagatgattgaaaaaattgacatgacaggtcga
gagggtagaaccaaagtccaggctcgaattgcccagcttagtgacattcatgcagtaaag
gaactgaatcttcaggaatacagacagcacccttgtgctcaggataatggtggctgttca
catatttgtcttgtaaagggagatggtactacaaggtgctcttgcccaatgcacttggtt
ctgcttcaggatgagctattatgtggagaacccccaacgtgttctcctcagcagtttacg
tgtttcacgggggaaatcgactgtatccctgtggcttggcggtgcgatgggtttactgaa
tgtgaagaccacagtgatgagctcaattgtcctgtgtgctccgagtcccagttccagtgt
gccagtgggcagtgtattgatggtgccctccgatgcaacggagacgcaaactgccaggat
aaatcagatgagaagaactgtgaagtgctttgtttaattgatcagttccgctgtgccaat
ggtcagtgcattggaaaacacaagaaatgtgatcataatttggattgcagtgacaaatcg
gatgaactggattgttatccaacagaggagccagcaccacaggccaccaatacagttggt
tcagttattggcgtaattgtcaccatttttgtgtctggaactatatacttcatctgccag
aggatgttgtgtccacgtatgaagggagatggggaaaccatgactaatgattatgtagtt
catggaccagcttctgtgccccttggttatgtgccacacccaggctctttgtcaggatct
cttccaggaatgtctcgaggtaaatcgatgatcagctcccttagcatcatggggggaagc
agtggacccccttatgaccgagctcatgtcacaggagcatcatcaagcagttcctcaagc
accaaaggcacttacttccctgcaattttgaaccctccaccatccccagccacagagcga
tcacattacactatggaattcggttattcttcaaacagtccttccactcataggtcctac
agctacaggccatacagttaccggcactttgcaccccccaccactccttgcagcacagat
gtttgtgacagtgactatgctcccagccggagaatgacctcagtggcgacggccaagggc
tacaccagtgacttgaactatgactcagagcctgtgcccccacctcccacaccccgaagc
caatacttgtcagcagaagagaactatgaaagctgcccaccttctccgtacacagagagg
agctactctcatcacctctacccaccgccgccctctccttgcacagactcctcctga

KEGG   Sus scrofa (pig): 100524299
Entry
100524299         CDS       T01009                                 

Gene name
LRP5
Definition
(RefSeq) low-density lipoprotein receptor-related protein 5 isoform X1
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04150  mTOR signaling pathway
ssc04310  Wnt signaling pathway
ssc04928  Parathyroid hormone synthesis, secretion and action
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05200  Pathways in cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100524299 (LRP5)
   04150 mTOR signaling pathway
    100524299 (LRP5)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100524299 (LRP5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100524299 (LRP5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100524299 (LRP5)
   05226 Gastric cancer
    100524299 (LRP5)
   05224 Breast cancer
    100524299 (LRP5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100524299 (LRP5)
   05022 Pathways of neurodegeneration - multiple diseases
    100524299 (LRP5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssc04131]
    100524299 (LRP5)
Membrane trafficking [BR:ssc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    100524299 (LRP5)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition Ldl_recept_a DUF5050 SGL Insulin_TMD
Other DBs
NCBI-GeneID: 100524299
NCBI-ProteinID: XP_020938378
Ensembl: ENSSSCG00000012885
LinkDB
Position
2
AA seq 1624 aa
MEAAPPRPPPPPPPLLLLLALCCSLAPAAASPLLLFANRRDVRLVDAGGVKLESTIVVSG
LEDAAAVDFQFSKGAVYWTDVSEEAIKQTYLNQTGAAVQNVVISGLVSPDGLACDWVGKK
LYWTDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGM
DGSSRKVIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPF
ALTLSGDTLYWTDWQTRSIHACNKRTGEKRKEILSALYSPMDIQVLSPERQPYFHTRCEE
DNGGCSHLCLLSPREPYYACACPTGVQLQGNGQTCKAGAEEVLLLARRTDLRRISLDTPD
FTDIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDGI
AVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIVLHPVMGLMYWTDWGES
PKIECAHLDGQERHVLVNTSLGWPNGLALDLQEGQLYWGDAKTDKIEVINIDGTERRTLL
EDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDIIIDQLPDLMGLKAVNVAKVVG
TNPCADRNGGCSHLCFFTPRATKCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLD
TNNNDVAIPLAGVKEASALDFDVSTNHIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPE
GMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWG
GKPRIVRAFMDGTNGMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERVVI
ADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQD
GLNDCMHNNGQCGQLCLAVPSGHRCSCASHYTLDPSSRNCSPPTTFLLFSQKCAVSRMIP
DDQHSPDLILPLHGLRNVRAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSPGQSQS
PDRQPHDLSIDVYGRTLFWTCEATNTINVHRLNGDAMGVVLRGDRDKPRAIVVNAERGYL
YFTNMQDRAAKIERAALDGTEREVLFTTGLIRPVALVVDNALGKLFWVDADLKRIESCDL
SGANRLTLEDANIVQPVGLTVLGKHLYWIDRQQQMIERVDKTTGDSRTRVQGRVAHLTGI
HAVEDISVEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSP
DQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGEA
DCQDRSDEADCDASLNARPLLAAVCLPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCE
ITKLPSDDSPAHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGATGPFPHEYVSGTP
HVPLNFIAPGGSQHGPFPGISCSKSMMSSVSLMGGRAGVPLYDRNHVTGASSSSSSSTKA
TLYPPILNPPPSPATDPSLYNLDVFYSSNIPAAARPYRPYIIRGMAPPTTPCSTDVCDSD
YSASRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSPC
TDSS
NT seq 4875 nt   +upstreamnt  +downstreamnt
atggaggcggcgccgccccggccgcccccgccgccgccgccgctgctgctgctgctcgcg
ctctgctgcagcttggcccccgccgcggcctcgccgctcctgctgtttgccaaccgccgg
gatgtgcggctggtggacgccggcggagtcaagctggagtccaccatcgtggtcagcggc
ctggaggacgcggccgcggtggacttccagttctccaagggggccgtgtactggacggac
gtgagtgaggaggccatcaagcagacctacctgaaccagacgggggcggccgtgcagaac
gtggtcatctccggcctggtgtcgcccgacggcctggcctgcgactgggtcggcaagaag
ctgtactggacggactcggagaccaatcgcatcgaggtggccaatctcaacgggacgtcg
cggaaggtcctcttctggcaggacctcgaccagccgcgggccatcgccttggaccctgct
cacgggtacatgtactggacagactggggtgagacaccccggatcgagcgggcggggatg
gacggcagcagccggaaggtcatcgtggactcggacatctactggcccaatgggctgacc
atcgacctggaggagcagaagctgtactgggccgacgccaagctcagcttcatccaccgg
gccaacctggacggctcgttccggcagaaggtggtggagggcagcctgacgcaccccttt
gccctgacgctctctggagacactctgtactggacggactggcagacccgctccatccac
gcctgtaacaagaggactggggagaagaggaaggagattctgagcgccctctactcgccc
atggacattcaggtcctcagccccgagcggcagccttacttccacacccggtgtgaggag
gacaacggcggctgctcccacctgtgcctgctgtccccgagggagccttactacgcgtgc
gcctgccccactggcgtgcagctgcagggcaacggccagacgtgcaaggcaggggccgag
gaggtgctgctgctggcccggaggacggacctgcggaggatctcgctggacacgccggac
ttcacggacatcgtgctgcaggtggacgacatccggcacgccatcgccatcgactacgac
ccgctggagggctacgtgtactggacggacgacgaggtgcgggccatccgcagggcgtac
ctggacgggtcgggggcgcagacgctggtcaacaccgagatcaacgacccggacggcatc
gcggtcgactgggtggcccgcaacctctactggacggacacgggcaccgaccgcatcgag
gtgacgcgcctcaacggcacctcccgcaagatcctggtgtccgaggacctggacgagccc
cgcgccatcgtgctgcaccccgtgatgggcctcatgtattggacagactggggggagagc
cccaaaattgagtgcgcccacctggacgggcaggagcggcacgtcctggtcaacacctcc
ctcggctggcccaacggactggctctggacctgcaggaggggcagctctactggggagac
gccaagacagacaagatagaggtgatcaacatcgacgggacggagaggcggacgctcctg
gaggacaagctcccgcacattttcgggttcacgctgctgggggacttcatctactggacc
gactggcagcggcgcagcatcgagcgcgtgcacaaggtcaaggccagccgggacatcatc
atcgaccagctgcctgacctgatggggctcaaggccgtgaacgtggccaaggtcgtcggg
accaacccgtgcgcggacaggaacgggggctgcagtcacctgtgcttcttcacgccgcgc
gccaccaagtgcggctgccccatcggcctggagctgctgagtgacatgaagacctgcatc
gtgcccgaggccttcctcgtgttcaccagcagggccgccatccaccggatctccctggac
accaacaacaacgacgtggccatcccgctcgcgggcgtcaaggaggcctccgcgctggac
ttcgacgtgtccactaaccacatctactggaccgacgtcagcctgaagaccatcagccga
gccttcatgaacgggagctccgtggagcacgtgatcgagtttggccttgactacccggaa
ggcatggccgtcgactggatgggcaagaacctctactgggcagacaccgggaccaacagg
atcgaagtggcccggctggacgggcagttccggcaggtcctcgtctggcgggacctggac
aacccgaggtccctggccctagaccccaccaaaggctacatctactggaccgagtggggc
ggcaagcccaggatcgtgcgggccttcatggacggcaccaacggcatgacgctggtggac
aaggtgggccgggccaacgacctcaccattgactacgccgaccagcgtctctactggacg
gacctggacaccaacatgattgagtcgtccaacatgctgggtcaggagagggtggtgatt
gccgacgacctcccgcaccccttcggcctgacccagtacagcgattacatctactggaca
gactggaacctgcacagcatcgagcgggccgacaagaccagtggccggaaccgcaccctg
atccagggccacctggacttcgtgatggacatcctggtgttccactcctcccgccaggac
ggcctcaacgactgcatgcacaacaacgggcagtgcgggcagctgtgcctggccgtcccc
agcggccaccgctgcagctgcgcctcacactacaccctggaccccagcagccgcaactgc
agcccgcccaccaccttcttgctgttcagccagaaatgcgccgtcagccggatgatcccc
gacgaccagcacagcccggacctcatcctgcccctgcacgggctgaggaacgtcagggcc
attgactacgacccactggacaagttcatctactgggtagatgggcgccagaacatcaaa
cgggccaaggacgacgggacccagcccttcgttctgacctctccgggccaaagccagagc
ccagacaggcagccccacgacctcagcatcgacgtctacggccggacactgttctggacg
tgcgaggccaccaacaccatcaacgtccaccggctgaacggggacgccatgggcgtggtg
ctccggggggaccgagacaagccgagggccatcgtcgtcaacgccgagcgagggtacctg
tacttcaccaacatgcaggaccgggcggccaagatcgagcgtgccgccctggatggcacc
gagcgtgaggtcctcttcaccacgggcctcatccgccccgtggccctcgtggtggacaac
gcgctgggcaagctcttttgggtggacgcagacctgaaacgcatcgagagctgcgacctg
tcaggggccaaccgcctgaccctggaggacgccaacatcgtgcagcccgtgggcctgact
gtgctgggcaagcacctctactggattgaccgccagcagcagatgatcgagcgcgtggac
aagaccacgggggactcgcggacacgggtgcagggccgtgtcgcccacctgaccggcatt
cacgccgtggaggacatcagcgtggaggagttctcagcccacccttgtgcccgggacaat
ggcggctgttcccacatctgcatcgccaagggtgatggaaccccacggtgctcatgccca
gtccaccttgtgctcctgcagaacctattgacttgtggtgagcctcccacatgctccccc
gaccagttcgcgtgtgccacaggggagatcgactgcatcccaggggcctggcgctgcgac
ggcttcccggagtgtgacgaccagagcgacgaagagggctgcccggtgtgctcggccgcc
cagttcccctgtgcgcggggccagtgcgtggacctgcggctgcgctgtgatggcgaggcg
gactgccaggaccgctccgacgaggcggactgcgatgcctccctgaacgcaaggcccctc
cttgcagccgtctgcctgcccaaccagttccggtgcgccagcggccagtgcgtcctcatc
aagcagcagtgcgactcctttcctgactgcatcgacggctccgacgagctcatgtgcgaa
atcaccaagctgccctcggacgacagcccggcccacagcagcgccatcgggcctgtcatc
ggcatcatcctgtcgctcttcgtcatgggcggggtctacttcgtgtgccagcgcgtggtg
tgtcagcgctacgcgggggccaccgggcccttcccgcacgagtacgtcagtgggaccccc
cacgtgcccctcaacttcatcgcgccgggcggctcccagcacgggcccttcccaggcatc
tcctgcagcaagtccatgatgagctccgtgagcctgatggggggccgggccggggtgccc
ctctacgaccggaaccacgtcaccggggcctcgtccagcagctcatccagcaccaaggcc
acgctgtacccgccgatcctgaacccgccaccatcccccgccacggacccctccctctac
aacctggacgtgttctactcctccaacattccggccgccgccaggccctacaggccctac
atcatccgcggcatggcgcccccgacgacgccctgcagtacagacgtgtgcgacagcgac
tacagcgccagccgctggaaggccagcaagtactacctggatttgaactcggactcagac
ccctacccacccccgcccacgccgcacagccagtacctgtcggcggaggacagctgcccg
ccttcgccagccacggagaggagttacttccacctcttcccgcccccaccgtccccctgc
acggactcgtcctga

DBGET integrated database retrieval system