KEGG   Sus scrofa (pig): 100516166
Entry
100516166         CDS       T01009                                 

Gene name
CAMK2B
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit beta isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04012  ErbB signaling pathway
ssc04020  Calcium signaling pathway
ssc04024  cAMP signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04114  Oocyte meiosis
ssc04217  Necroptosis
ssc04261  Adrenergic signaling in cardiomyocytes
ssc04310  Wnt signaling pathway
ssc04360  Axon guidance
ssc04713  Circadian entrainment
ssc04720  Long-term potentiation
ssc04722  Neurotrophin signaling pathway
ssc04725  Cholinergic synapse
ssc04728  Dopaminergic synapse
ssc04740  Olfactory transduction
ssc04750  Inflammatory mediator regulation of TRP channels
ssc04911  Insulin secretion
ssc04912  GnRH signaling pathway
ssc04916  Melanogenesis
ssc04921  Oxytocin signaling pathway
ssc04922  Glucagon signaling pathway
ssc04925  Aldosterone synthesis and secretion
ssc04934  Cushing syndrome
ssc04971  Gastric acid secretion
ssc05012  Parkinson disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05031  Amphetamine addiction
ssc05152  Tuberculosis
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05214  Glioma
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100516166 (CAMK2B)
   04310 Wnt signaling pathway
    100516166 (CAMK2B)
   04066 HIF-1 signaling pathway
    100516166 (CAMK2B)
   04020 Calcium signaling pathway
    100516166 (CAMK2B)
   04024 cAMP signaling pathway
    100516166 (CAMK2B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100516166 (CAMK2B)
   04217 Necroptosis
    100516166 (CAMK2B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100516166 (CAMK2B)
   04922 Glucagon signaling pathway
    100516166 (CAMK2B)
   04912 GnRH signaling pathway
    100516166 (CAMK2B)
   04921 Oxytocin signaling pathway
    100516166 (CAMK2B)
   04916 Melanogenesis
    100516166 (CAMK2B)
   04925 Aldosterone synthesis and secretion
    100516166 (CAMK2B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100516166 (CAMK2B)
  09154 Digestive system
   04971 Gastric acid secretion
    100516166 (CAMK2B)
  09156 Nervous system
   04725 Cholinergic synapse
    100516166 (CAMK2B)
   04728 Dopaminergic synapse
    100516166 (CAMK2B)
   04720 Long-term potentiation
    100516166 (CAMK2B)
   04722 Neurotrophin signaling pathway
    100516166 (CAMK2B)
  09157 Sensory system
   04740 Olfactory transduction
    100516166 (CAMK2B)
   04750 Inflammatory mediator regulation of TRP channels
    100516166 (CAMK2B)
  09158 Development and regeneration
   04360 Axon guidance
    100516166 (CAMK2B)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100516166 (CAMK2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100516166 (CAMK2B)
   05205 Proteoglycans in cancer
    100516166 (CAMK2B)
  09162 Cancer: specific types
   05214 Glioma
    100516166 (CAMK2B)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100516166 (CAMK2B)
   05022 Pathways of neurodegeneration - multiple diseases
    100516166 (CAMK2B)
  09165 Substance dependence
   05031 Amphetamine addiction
    100516166 (CAMK2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100516166 (CAMK2B)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100516166 (CAMK2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100516166 (CAMK2B)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100516166 (CAMK2B)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   100516166 (CAMK2B)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 SnoaL_2 APH Kdo Pkinase_fungal SnoaL_4
Other DBs
NCBI-GeneID: 100516166
NCBI-ProteinID: XP_020934294
LinkDB
Position
18
AA seq 646 aa
MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLER
EARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKL
KGAILTTMLATRNFSVGRQTTAPATMSTAASGTTMGLVEQAAKSLLNKKADGVKPQTNST
KNSAAATSPKGTLPPAALEPQTTVIHNPVDGIKESSDSTHTTIEDEDTKAPRVPDILSSV
RRGSGTPDVEGPPPCLSPAPISPLPTPSPRISDLLSSVRRGSGTPEAEGPLPTPSPRISN
ILNTVRRGSGTPEAQGPPPCPSPALPGPPPTPTRKQEIIKITEQLIEAVNNGDFEAYAKI
CDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHTTILNPHVHVIGEDAACIAYI
RLTQYIDGQGRPRTSQSKETRVWHRRDGKWQNVHFHCSGAPVAPLQ
NT seq 1941 nt   +upstreamnt  +downstreamnt
atggccaccacggtgacttgcacccgcttcaccgacgagtaccagctctacgaggatatt
ggcaagggggctttctctgtggtccgacgctgtgtcaagctctgcaccggccacgagtac
gcagccaagatcatcaacaccaagaagctctcggcccgagatcaccagaagctggagagg
gaggctcgaatctgccgtcttctgaagcattccaacatcgtgcgactccatgacagcatc
tcggaggaaggcttccactacctggtcttcgacctggtcactggcggggagctctttgaa
gacatcgtggcgagagagtactacagcgaggcggacgccagtcactgcatccagcagatc
ctggaggcggttctccattgccaccaaatgggggtcgtccacagggacctcaagcccgag
aacctgctcctggccagcaagtgcaaaggggccgcagtgaagctggcggactttggcctg
gctatcgaggtgcagggggaccagcaggcatggtttgggttcgctggcacgccaggctac
ctatccccggaagtcctgcgcaaggaggcgtacggcaagccggtggacatctgggcgtgc
ggggtgatcctctacatcctgctcgtgggctacccgcccttctgggacgaggaccagcac
aagctgtaccagcagatcaaggccggagcctatgacttcccgtcccccgagtgggacacg
gtcactcctgaagccaaaaacctcatcaaccagatgttgaccattaaccctgccaagcgc
atcacagcgcacgaggcgctgaagcacccgtgggtctgccaacgctccaccgtggcctcc
atgatgcacaggcaggagacggtggagtgcctgaagaagttcaatgcccggaggaagctc
aagggcgccatcctcaccaccatgctggccacacggaatttctcagtgggcagacagacc
accgctccggccacaatgtccaccgcggcctccggcaccaccatggggctggtggaacaa
gcagccaagagtttactcaacaagaaagcagacggagtcaagccccagacgaatagcacc
aaaaacagtgcagctgccaccagccccaaggggacacttcctccagctgccctggagcct
caaaccaccgtcattcataacccagtggacgggatcaaggagtcatctgacagcacccac
accaccatagaggatgaagacacaaaagcccccagggtccccgacatcctgagctccgtg
aggaggggctcggggaccccagacgtcgagggccccccgccctgcctgtctccggctccc
attagccccctacccaccccatccccccggatctctgacctcctgagctccgtgaggagg
ggctcggggaccccggaagccgagggccccctgcccaccccatcccccaggatctctaac
atcctgaacacggtgaggaggggttcggggaccccagaagcccagggccccccaccctgc
ccgtctccggctctcccaggccccccacccaccccgacgaggaagcaggagattattaag
atcaccgagcagctcatcgaggccgtcaacaacggggacttcgaggcctacgcgaaaatc
tgcgacccaggcctgacctcctttgagcccgaagccctgggcaatctggttgaaggaatg
gacttccacagattctactttgagaatttgctcgccaagaacagcaagccgatccacaca
accatcctgaacccgcacgtgcacgtcatcggcgaggacgccgcctgcatcgcctacatc
cgcctgacgcagtacatcgacgggcagggccggccccgcaccagccagtccaaggagacc
cgcgtgtggcaccgccgagatggcaagtggcagaacgtgcacttccactgctcgggggca
cccgtggccccgctgcagtga

KEGG   Sus scrofa (pig): 100626014
Entry
100626014         CDS       T01009                                 

Gene name
CAMK2A
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit alpha isoform X7
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04012  ErbB signaling pathway
ssc04020  Calcium signaling pathway
ssc04024  cAMP signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04114  Oocyte meiosis
ssc04217  Necroptosis
ssc04261  Adrenergic signaling in cardiomyocytes
ssc04310  Wnt signaling pathway
ssc04360  Axon guidance
ssc04713  Circadian entrainment
ssc04720  Long-term potentiation
ssc04722  Neurotrophin signaling pathway
ssc04725  Cholinergic synapse
ssc04728  Dopaminergic synapse
ssc04740  Olfactory transduction
ssc04750  Inflammatory mediator regulation of TRP channels
ssc04911  Insulin secretion
ssc04912  GnRH signaling pathway
ssc04916  Melanogenesis
ssc04921  Oxytocin signaling pathway
ssc04922  Glucagon signaling pathway
ssc04925  Aldosterone synthesis and secretion
ssc04934  Cushing syndrome
ssc04971  Gastric acid secretion
ssc05012  Parkinson disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05031  Amphetamine addiction
ssc05152  Tuberculosis
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05214  Glioma
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100626014 (CAMK2A)
   04310 Wnt signaling pathway
    100626014 (CAMK2A)
   04066 HIF-1 signaling pathway
    100626014 (CAMK2A)
   04020 Calcium signaling pathway
    100626014 (CAMK2A)
   04024 cAMP signaling pathway
    100626014 (CAMK2A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100626014 (CAMK2A)
   04217 Necroptosis
    100626014 (CAMK2A)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100626014 (CAMK2A)
   04922 Glucagon signaling pathway
    100626014 (CAMK2A)
   04912 GnRH signaling pathway
    100626014 (CAMK2A)
   04921 Oxytocin signaling pathway
    100626014 (CAMK2A)
   04916 Melanogenesis
    100626014 (CAMK2A)
   04925 Aldosterone synthesis and secretion
    100626014 (CAMK2A)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100626014 (CAMK2A)
  09154 Digestive system
   04971 Gastric acid secretion
    100626014 (CAMK2A)
  09156 Nervous system
   04725 Cholinergic synapse
    100626014 (CAMK2A)
   04728 Dopaminergic synapse
    100626014 (CAMK2A)
   04720 Long-term potentiation
    100626014 (CAMK2A)
   04722 Neurotrophin signaling pathway
    100626014 (CAMK2A)
  09157 Sensory system
   04740 Olfactory transduction
    100626014 (CAMK2A)
   04750 Inflammatory mediator regulation of TRP channels
    100626014 (CAMK2A)
  09158 Development and regeneration
   04360 Axon guidance
    100626014 (CAMK2A)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100626014 (CAMK2A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100626014 (CAMK2A)
   05205 Proteoglycans in cancer
    100626014 (CAMK2A)
  09162 Cancer: specific types
   05214 Glioma
    100626014 (CAMK2A)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100626014 (CAMK2A)
   05022 Pathways of neurodegeneration - multiple diseases
    100626014 (CAMK2A)
  09165 Substance dependence
   05031 Amphetamine addiction
    100626014 (CAMK2A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100626014 (CAMK2A)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100626014 (CAMK2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100626014 (CAMK2A)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100626014 (CAMK2A)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   100626014 (CAMK2A)
SSDB
Motif
Pfam: Sulfatase Sulfatase_C DUF4994
Other DBs
NCBI-GeneID: 100626014
NCBI-ProteinID: XP_003124150
LinkDB
Position
2
AA seq 428 aa
MVGKWHLGFYRKECLPTRRGFDTFLGSLTGNVDYYTYDNCDGPGVCGFDLHEGESVAWGL
SGQYSTLLYAQRVSRILAGHSPRRPLFLYVAFQAVHTPLQSPREYLYRYRGMGNVARRKY
AAMVTCMDEAVRNITGALKRYGFYNNSVIIFSSDNGGQTFSGGSNWPLRGRKGTYWEGGV
RGLGFVHSPLLKRTRRTSRALLHITDWYPTLVGLAGGTASAADGLDGYDVWPAISEGRAS
PRTEILHNIDPLYNHARHGSLEGGFGIWNTAVQAAIRVGEWKLLTGDPGYGDWIPPQTLA
AFPGSWWNLERMASARQAVWLFNISADPYEREDLAGQRPDVVRALLARLVDYNRTAIPVR
YPAENPRAHPDFNGGAWGPWASDEDEDEEEGAGRARSLSRGRRKKKCKICKLRSFFRKLN
TRLMSQRI
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggtgggcaagtggcacctgggcttctaccggaaggagtgcctgcccacgcgccggggc
ttcgacaccttcctgggctccctcaccggcaacgtggactactacacctacgacaactgc
gacggcccgggggtgtgcggcttcgacctgcacgagggcgagagcgtggcctgggggctc
agcggccagtactccaccctgctctatgcccagcgcgtcagccgcatcctagccggccac
agcccccggcggccgctcttcctctacgtggccttccaggccgtgcacacgcccctgcag
tccccgcgcgagtacctgtaccgctaccgcggcatgggcaacgtggcgcggcgcaagtac
gcggccatggtcacctgcatggacgaggccgtgcgcaacatcacgggcgccctcaagcgc
tacggcttctacaacaacagcgtcatcatcttctccagtgacaacgggggccagaccttc
tcggggggcagcaactggccgctgcgagggcgcaagggcacctactgggaagggggcgtg
cggggcctgggcttcgtgcacagccccctgctcaagcgcacgcgacggaccagccgcgca
ctgctgcacatcaccgactggtacccgaccctggtgggcctggcaggcggcactgcctcg
gcggccgacgggctggacggctatgacgtgtggcccgccatcagcgagggccgggcctcg
ccacgcacggagatcctgcacaacatcgaccccctctacaaccacgcccggcacggctcc
ctggagggcggcttcggcatctggaacactgccgtgcaggccgccatccgagtgggcgag
tggaagctgctgaccggagaccccggctacggggactggatcccgccgcagacgctggcc
gccttccccggcagctggtggaacctggagcggatggccagcgcccgccaggccgtgtgg
ctcttcaacatcagcgccgacccctacgaacgggaggacctcgcgggccagcggccggat
gtggtccgggccctgctggcccgcctggtggactataaccgcactgccatccctgtccgc
tacccggctgagaacccccgggcccatccggactttaacgggggcgcctgggggccctgg
gccagcgacgaggacgaagacgaagaggagggggcgggcagggcgcggagcctctcccgg
gggcgccgcaagaaaaaatgcaagatttgcaagctgcgatccttttttcgtaaactcaac
accagactgatgtcccagcggatctga

KEGG   Sus scrofa (pig): 397394
Entry
397394            CDS       T01009                                 

Gene name
CAMK2G
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit gamma
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04012  ErbB signaling pathway
ssc04020  Calcium signaling pathway
ssc04024  cAMP signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04114  Oocyte meiosis
ssc04217  Necroptosis
ssc04261  Adrenergic signaling in cardiomyocytes
ssc04310  Wnt signaling pathway
ssc04360  Axon guidance
ssc04713  Circadian entrainment
ssc04720  Long-term potentiation
ssc04722  Neurotrophin signaling pathway
ssc04725  Cholinergic synapse
ssc04728  Dopaminergic synapse
ssc04740  Olfactory transduction
ssc04750  Inflammatory mediator regulation of TRP channels
ssc04911  Insulin secretion
ssc04912  GnRH signaling pathway
ssc04916  Melanogenesis
ssc04921  Oxytocin signaling pathway
ssc04922  Glucagon signaling pathway
ssc04925  Aldosterone synthesis and secretion
ssc04934  Cushing syndrome
ssc04971  Gastric acid secretion
ssc05012  Parkinson disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05031  Amphetamine addiction
ssc05152  Tuberculosis
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05214  Glioma
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    397394 (CAMK2G)
   04310 Wnt signaling pathway
    397394 (CAMK2G)
   04066 HIF-1 signaling pathway
    397394 (CAMK2G)
   04020 Calcium signaling pathway
    397394 (CAMK2G)
   04024 cAMP signaling pathway
    397394 (CAMK2G)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    397394 (CAMK2G)
   04217 Necroptosis
    397394 (CAMK2G)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    397394 (CAMK2G)
   04922 Glucagon signaling pathway
    397394 (CAMK2G)
   04912 GnRH signaling pathway
    397394 (CAMK2G)
   04921 Oxytocin signaling pathway
    397394 (CAMK2G)
   04916 Melanogenesis
    397394 (CAMK2G)
   04925 Aldosterone synthesis and secretion
    397394 (CAMK2G)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    397394 (CAMK2G)
  09154 Digestive system
   04971 Gastric acid secretion
    397394 (CAMK2G)
  09156 Nervous system
   04725 Cholinergic synapse
    397394 (CAMK2G)
   04728 Dopaminergic synapse
    397394 (CAMK2G)
   04720 Long-term potentiation
    397394 (CAMK2G)
   04722 Neurotrophin signaling pathway
    397394 (CAMK2G)
  09157 Sensory system
   04740 Olfactory transduction
    397394 (CAMK2G)
   04750 Inflammatory mediator regulation of TRP channels
    397394 (CAMK2G)
  09158 Development and regeneration
   04360 Axon guidance
    397394 (CAMK2G)
  09159 Environmental adaptation
   04713 Circadian entrainment
    397394 (CAMK2G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    397394 (CAMK2G)
   05205 Proteoglycans in cancer
    397394 (CAMK2G)
  09162 Cancer: specific types
   05214 Glioma
    397394 (CAMK2G)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    397394 (CAMK2G)
   05022 Pathways of neurodegeneration - multiple diseases
    397394 (CAMK2G)
  09165 Substance dependence
   05031 Amphetamine addiction
    397394 (CAMK2G)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    397394 (CAMK2G)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    397394 (CAMK2G)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    397394 (CAMK2G)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     397394 (CAMK2G)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   397394 (CAMK2G)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr SnoaL_3 DUF4440 APH Pkinase_fungal Kdo SnoaL_2 RIO1
Other DBs
NCBI-GeneID: 397394
NCBI-ProteinID: NP_999358
Ensembl: ENSSSCG00000010311
UniProt: Q7JFN2
LinkDB
Position
14
AA seq 539 aa
MATTATCTRFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQI
LESVNHIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKL
KGAILTTMLVSRNFSVGRQSSAPASPAASAAGLAGQAAKSLLNKKSDGGVKPQSNNKNSL
VSPAQEPAPLQTAMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKVRKQEIIKITEQLIE
AINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHV
HVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYHCSGAPAAPLQ
NT seq 1620 nt   +upstreamnt  +downstreamnt
atggccaccaccgccacctgcacccgcttcaccgacgactaccagctcttcgaggagctc
ggcaagggtgctttctctgtggtccgcaggtgtgtgaagaaaacctccacgcaggaatat
gcagcaaaaatcatcaataccaagaagttatctgcccgggatcaccagaaactagaacgt
gaggcccggatatgccgacttttgaaacatccaaacattgtacgcctccatgacagtatt
tctgaagaagggtttcactacctcgtgtttgaccttgttactggcggggagctgtttgaa
gacattgtggccagagagtactacagtgaagctgatgccagccactgtatacatcagatt
ctggagagtgttaaccacatccaccagcatgacatcgtccaccgggacctgaagcctgag
aacctgctgctggcgagtaaatgcaagggtgccgccgtcaagctagctgattttggccta
gccatcgaagtacagggagagcaacaggcttggtttggttttgctggcaccccaggttac
ttgtcccctgaggtcttgaggaaagatccctatggaaaacctgtggatatctgggcctgc
ggggtcatcctgtatatcctcctggtgggctaccctcccttttgggatgaggatcagcat
aagctgtatcaacagatcaaggctggagcctatgacttcccatcaccagagtgggacacg
gtgactcctgaagccaagaacttgatcaaccagatgctgactataaaccccgcaaagcgt
atcacagctgaccaggctctcaaacacccatgggtctgccaacggtccacagtggcatct
atgatgcatcgtcaagagactgtggagtgcttgcgcaagttcaatgcccggagaaaacta
aagggtgccatccttacgaccatgcttgtctccaggaacttttcagttggcaggcagagc
tccgcccccgcctcgcctgccgcgagcgccgccggcctggccgggcaagctgccaaaagc
ctactgaacaagaagtcggatggcggtgtcaagccacagagcaacaacaaaaacagtctc
gtaagcccagcccaagagcctgcgcccttgcagacggccatggagcctcaaaccaccgtg
gtgcacaatgctacagatgggatcaagggctccacagagagctgcaataccaccacagaa
gatgaggaccttaaagtgcgaaaacaggagatcattaagatcacagaacagctgattgag
gccatcaacaatggggactttgaggcctacacgaagatttgtgatccaggcctcacctcc
tttgagcctgaggcccttggtaacctggtggaagggatggatttccataagttttacttt
gagaatctcttatccaagaacagcaagcccatccacaccaccatcctgaacccgcatgtc
cacgtgatcggagaggacgcagcttgcatcgcctatatccgcctcacccagtacatcgat
gggcagggtcggcctcgcaccagccagtcggaggagacccgggtctggcaccgccgggat
ggcaagtggctcaatgtccactaccactgctcaggggcccctgccgcaccgctgcagtga

KEGG   Sus scrofa (pig): 397674
Entry
397674            CDS       T01009                                 

Gene name
CAMK2D
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit delta
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04012  ErbB signaling pathway
ssc04020  Calcium signaling pathway
ssc04024  cAMP signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04114  Oocyte meiosis
ssc04217  Necroptosis
ssc04261  Adrenergic signaling in cardiomyocytes
ssc04310  Wnt signaling pathway
ssc04360  Axon guidance
ssc04713  Circadian entrainment
ssc04720  Long-term potentiation
ssc04722  Neurotrophin signaling pathway
ssc04725  Cholinergic synapse
ssc04728  Dopaminergic synapse
ssc04740  Olfactory transduction
ssc04750  Inflammatory mediator regulation of TRP channels
ssc04911  Insulin secretion
ssc04912  GnRH signaling pathway
ssc04916  Melanogenesis
ssc04921  Oxytocin signaling pathway
ssc04922  Glucagon signaling pathway
ssc04925  Aldosterone synthesis and secretion
ssc04934  Cushing syndrome
ssc04971  Gastric acid secretion
ssc05012  Parkinson disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05031  Amphetamine addiction
ssc05152  Tuberculosis
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05214  Glioma
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    397674 (CAMK2D)
   04310 Wnt signaling pathway
    397674 (CAMK2D)
   04066 HIF-1 signaling pathway
    397674 (CAMK2D)
   04020 Calcium signaling pathway
    397674 (CAMK2D)
   04024 cAMP signaling pathway
    397674 (CAMK2D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    397674 (CAMK2D)
   04217 Necroptosis
    397674 (CAMK2D)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    397674 (CAMK2D)
   04922 Glucagon signaling pathway
    397674 (CAMK2D)
   04912 GnRH signaling pathway
    397674 (CAMK2D)
   04921 Oxytocin signaling pathway
    397674 (CAMK2D)
   04916 Melanogenesis
    397674 (CAMK2D)
   04925 Aldosterone synthesis and secretion
    397674 (CAMK2D)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    397674 (CAMK2D)
  09154 Digestive system
   04971 Gastric acid secretion
    397674 (CAMK2D)
  09156 Nervous system
   04725 Cholinergic synapse
    397674 (CAMK2D)
   04728 Dopaminergic synapse
    397674 (CAMK2D)
   04720 Long-term potentiation
    397674 (CAMK2D)
   04722 Neurotrophin signaling pathway
    397674 (CAMK2D)
  09157 Sensory system
   04740 Olfactory transduction
    397674 (CAMK2D)
   04750 Inflammatory mediator regulation of TRP channels
    397674 (CAMK2D)
  09158 Development and regeneration
   04360 Axon guidance
    397674 (CAMK2D)
  09159 Environmental adaptation
   04713 Circadian entrainment
    397674 (CAMK2D)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    397674 (CAMK2D)
   05205 Proteoglycans in cancer
    397674 (CAMK2D)
  09162 Cancer: specific types
   05214 Glioma
    397674 (CAMK2D)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    397674 (CAMK2D)
   05022 Pathways of neurodegeneration - multiple diseases
    397674 (CAMK2D)
  09165 Substance dependence
   05031 Amphetamine addiction
    397674 (CAMK2D)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    397674 (CAMK2D)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    397674 (CAMK2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    397674 (CAMK2D)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     397674 (CAMK2D)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   397674 (CAMK2D)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 Pkinase_fungal Kdo SnoaL_2 SnoaL_4 DUF4915
Other DBs
NCBI-GeneID: 397674
NCBI-ProteinID: NP_999546
Ensembl: ENSSSCG00000009123
UniProt: Q95266
LinkDB
Position
8
AA seq 499 aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDT
VTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSAAKSLLKKPDGVKESTESSNTTIEDEDVKARKQEIIKVTEQLIEA
INNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVH
LVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPS
CIPNGKENFSGSTSLWQNI
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggcttcaactacaacctgcaccaggttcacggacgagtatcagcttttcgaggagctt
ggaaagggggcattctcagtggtgagaagatgtatgaaaatccctactggacaagaatat
gctgccaaaattatcaacaccaaaaagctttctgctagggatcatcaaaaactggaaagg
gaagctagaatctgccgtcttttgaagcaccccaatattgtgcgacttcatgacagcata
tcagaagagggctttcattacttggtgtttgatttggttactggaggtgaactgtttgaa
gacatagtggcgagagaatattacagtgaagctgatgccagtcattgtatacagcagatt
ctagaaagtgtaaatcattgtcacctaaatggcatagttcacagggacttgaagcctgag
aatttgcttttagctagcaaatccaagggagcagctgtgaaactggcagactttggctta
gccatagaagttcaaggagaccagcaggcgtggttcggttttgctggcacacctggctat
ctttctccggaagttttacgtaaagatccttatggaaagccagtggacatgtgggcatgt
ggagtcattctctacattctgctggttggatacccacccttctgggatgaagaccaacac
cgactctatcagcagatcaaggctggagcttatgattttccatcaccagaatgggacaca
gtgactcctgaagccaaagacctcatcaataaaatgcttactatcaaccccgccaagcgt
atcacagcctcagaggcactgaagcacccatggatctgtcaacgttctactgttgcttcc
atgatgcacagacaggagactgtagactgcttgaagaaattcaatgccagaagaaaacta
aagggtgccatcttgacaactatgctggctacgaggaatttttcagcagccaagagtttg
ttgaagaaacctgatggagtgaaggagtcaactgagagttcaaatacaacgattgaggat
gaagatgtgaaagcacgaaagcaagagattatcaaagtcactgaacaattgattgaagct
atcaacaacggggactttgaagcttacacaaaaatctgtgacccaggccttactgctttt
gaacctgaagctttgggtaatttagtggaaggaatggactttcatcgattctactttgaa
aatgctttgtccaaaagcaataaaccaatccacactattatcctgaacccccacgttcat
ctggtaggtgacgatgctgcctgcatagcgtacattaggctcacacagtacatggatggc
agcggaatgccaaaaacaatgcagtccgaagagacacgtgtgtggcatcgccgggatgga
aagtggcagaatgttcattttcatcgctctgggtcgccaacagtacccatcaagccatcc
tgtattccaaatgggaaagaaaacttctcaggaagcacctctttgtggcaaaacatctaa

DBGET integrated database retrieval system