KEGG   Sus scrofa (pig): 100516621
Entry
100516621         CDS       T01009                                 

Gene name
NRG4
Definition
(RefSeq) pro-neuregulin-4, membrane-bound isoform isoform X2
  KO
K05458  neuregulin 4
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04012  ErbB signaling pathway
ssc05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100516621 (NRG4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100516621 (NRG4)
Cytokines and growth factors [BR:ssc04052]
 Growth factors
  Growth factors (RTK binding)
   100516621 (NRG4)
SSDB
Motif
Pfam: EGF EGF_2 Gram_pos_anchor DUF3481 Laminin_EGF
Other DBs
NCBI-GeneID: 100516621
NCBI-ProteinID: XP_005656332
UniProt: A0A4X1TYN8
LinkDB
Position
7
AA seq 116 aa
MPTDHEEPCGPSHRSFCLNGGICYVIPTIPSPFCRCIENYTGARCEEVFLPSSSIQTESD
LFTTFAALAVLLGTLIIGVLYFLCRKGHLQRASSVQYDISLVETSSTSAHHSHAEH
NT seq 351 nt   +upstreamnt  +downstreamnt
atgccaacagatcacgaagagccctgtggtcccagtcacaggtcattttgcctgaatgga
gggatttgttatgtgatacctactattcccagccccttttgtagatgcatcgaaaattac
acaggagctcgttgtgaagaggtttttctcccaagttccagcatccaaactgaaagtgac
ctgttcacaacttttgcagcattggctgttcttctggggactctcatcattggagtcctc
tacttcctttgcaggaagggccaccttcagagggccagttcagtccagtatgatatcagc
ctggtagagacaagcagtaccagtgcccaccacagtcatgcagaacattga

DBGET integrated database retrieval system