KEGG   Sus scrofa (pig): 100516641Help
Entry
100516641         CDS       T01009                                 

Gene name
ERBB2
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-2 precursor
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc01522  Endocrine resistance
ssc01524  Platinum drug resistance
ssc04010  MAPK signaling pathway
ssc04012  ErbB signaling pathway
ssc04020  Calcium signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04510  Focal adhesion
ssc04520  Adherens junction
ssc04530  Tight junction
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05206  MicroRNAs in cancer
ssc05212  Pancreatic cancer
ssc05213  Endometrial cancer
ssc05215  Prostate cancer
ssc05219  Bladder cancer
ssc05223  Non-small cell lung cancer
ssc05224  Breast cancer
ssc05226  Gastric cancer
ssc05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100516641 (ERBB2)
   04012 ErbB signaling pathway
    100516641 (ERBB2)
   04066 HIF-1 signaling pathway
    100516641 (ERBB2)
   04020 Calcium signaling pathway
    100516641 (ERBB2)
   04151 PI3K-Akt signaling pathway
    100516641 (ERBB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100516641 (ERBB2)
   04520 Adherens junction
    100516641 (ERBB2)
   04530 Tight junction
    100516641 (ERBB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100516641 (ERBB2)
   05206 MicroRNAs in cancer
    100516641 (ERBB2)
   05205 Proteoglycans in cancer
    100516641 (ERBB2)
   05230 Central carbon metabolism in cancer
    100516641 (ERBB2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100516641 (ERBB2)
   05226 Gastric cancer
    100516641 (ERBB2)
   05219 Bladder cancer
    100516641 (ERBB2)
   05215 Prostate cancer
    100516641 (ERBB2)
   05213 Endometrial cancer
    100516641 (ERBB2)
   05224 Breast cancer
    100516641 (ERBB2)
   05223 Non-small cell lung cancer
    100516641 (ERBB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100516641 (ERBB2)
   01524 Platinum drug resistance
    100516641 (ERBB2)
   01522 Endocrine resistance
    100516641 (ERBB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100516641 (ERBB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssc04147]
    100516641 (ERBB2)
   04090 CD molecules [BR:ssc04090]
    100516641 (ERBB2)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100516641 (ERBB2)
Protein kinases [BR:ssc01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100516641 (ERBB2)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100516641 (ERBB2)
CD molecules [BR:ssc04090]
 Proteins
  100516641 (ERBB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100516641
NCBI-ProteinID: NP_001302542
Ensembl: ENSSSCG00000017497
Vega: OTTSUSG00000002335
UniProt: A0A0D4CYJ6
LinkDB All DBs
Position
12
AA seq 1255 aa AA seqDB search
MELAAWCRWGLLLALLPPGAASTQVCTGTDMKLQLPASPETHLDMLRHLYQGCQVVQGNL
ELTYLPANANLFFLQEIQEVQGYVLIAHNRVSRVPLQRLRIVRGTQLFEDRYALAVLDNG
DLLESATPAAGAAAEGLQELQLQSLTEILKGGVLIQRNPQLCHQDTILWKDIFHKNNPLT
TVAVEANRSRACPPCSPACKASHCWGESSKDCQSLTRTICAGGCARCKGPLPTDCCHEQC
AAGCTGPKHSDCLACFHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACP
YNYLSTDVGSCTLVCPPNNQEVTAEDGTQRCEKCSKPCAQVCYGLGIEHLREVRAVTSAN
IQEFAGCRKIFGSLAFLPESFEGDPASSTAPLQPEQLRVFETLEEITGYLYISAWPDSLP
DLSVFQNLRVIRGRVLHDGAYSLTLQGLGISWLGLRSLRELGSGLALIHRNARLCFVHTV
PWDQLFRNPHQALLHSANRPEEECVGEGLTCYQLCAHGHCWGPGPTQCVNCSQFLRGQEC
VKECRVQQGHPREYVKDRYCLPCHPECQPQNGSDTCFGSEADQCVACAHYKDPPFCVARC
PSGVKPDLSFMPIWKFPDEDGMCQPCPINCTHSCVDLDDKGCPAEQRASPASSIIAGVVG
VLLAAVIGVVFGTLIKRRRQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETEL
RKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSP
YVSRLLGICLTSTVQLVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSYLEDVR
LVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFT
HQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWM
IDSECRPRFRELVAEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMGDLVDA
EEYLVPQQGFFCPDPAPGAGGTAHRRHRSTSTRSGGGELTLGLEASEEEPPKSPLAPSEG
AGSDVFDGDLGMGAAKGLQNLPQHDSSPLQRYSEDPTVPLPPETDGYVAPLTCSPQPEYV
NQPEVRPQPPSPLEGPLPPPRPTGATLERPKTLSPGRNGVVKDVFAFGAAVENPEYLAPR
GRAPSQNHPSPAFSPAFDNLYYWDQDPSDRGALPSTFEGTPTAENPEYLGLDVPV
NT seq 3768 nt NT seq  +upstreamnt  +downstreamnt
atggagctggcggcctggtgccgctgggggctcctcctcgccctcctgccccccggagcc
gcgagcacccaagtgtgcaccggcacagacatgaagctgcagctgccagccagtcctgag
acccacctggacatgctccgccacctctaccagggctgtcaggtggtacagggtaacctg
gagctcacctacctgccggctaatgccaacctcttcttcttgcaggagatccaggaggtg
cagggctacgtgcttatcgctcacaaccgagtgagtcgggtcccgctgcagaggctgcga
atcgtgcgaggtacccagctctttgaagacagatatgccctggctgtgctggacaatgga
gaccttctggaaagtgccacccctgctgcgggtgctgccgcagaagggctgcaggagctg
cagctgcaaagcctcacagagatcctgaagggaggagtcttgatccagcggaacccccag
ctctgccaccaggacacgattctgtggaaggacatcttccacaagaacaaccccctgacc
acagtggcggtagaagccaaccgctcccgggcctgcccaccctgttctccagcttgtaaa
gcttcccactgctggggagaaagttccaaggactgtcagagcttgacgcgaaccatctgt
gccggtggctgtgcccgctgtaagggcccgctgcccaccgactgctgccatgagcagtgt
gctgccggctgcacgggccccaagcactctgactgcctggcctgcttccacttcaaccac
agcggcatctgtgagctgcattgcccggccctggtcacctacaacacagacaccttcgag
tccatgcccaaccccgagggccgttacacctttggcgccagctgcgtgaccgcctgtcct
tacaactacctgtctacggacgtgggatcctgcaccctggtttgtcccccgaacaaccaa
gaggtgacagctgaggacggaacgcagcggtgtgagaaatgcagcaagccctgtgcccaa
gtgtgctacggtctgggcatagaacacctgcgggaggtgagggcggtcaccagcgccaat
atccaggagtttgctggctgcaggaagatctttgggagcctggcatttctgccagagagc
tttgagggggacccagcctccagcactgcccccctacagcctgagcagctcagagtgttt
gagactctggaggagatcacaggttacctgtacatctccgcttggccagatagcctgcct
gacctcagtgttttccagaacctgcgagtaatccggggacgagttctgcatgatggtgcc
tactcgctgaccctgcaagggctgggcatcagctggctggggctgcgctcgctgcgggag
ctgggcagcgggctggccctcatccaccgcaacgcccgcctctgcttcgtgcatacggtg
ccctgggaccagctcttccggaaccctcaccaggccctgctccacagtgccaaccggcca
gaggaggagtgcgtgggcgagggcctgacctgctaccagctgtgcgcacacgggcactgc
tggggtccagggcccacccagtgcgtaaactgcagccagttccttcggggccaagagtgc
gtgaaggagtgccgagtacagcaggggcacccccgggagtacgtgaaggacaggtactgt
ctgccgtgccaccccgagtgtcagccccagaatggctccgacacctgctttggctcggag
gctgaccagtgtgtggcttgcgcccactacaaggatccccccttctgcgtggctcgttgc
cccagtggtgtgaagcctgacctctccttcatgcccatctggaagttcccggatgaggat
ggcatgtgccagccgtgccccatcaactgcacccactcctgtgtggacctggacgacaag
ggctgccctgcagagcagagagccagccccgcgtcgtccatcattgccggcgtggtgggc
gttctgctggccgccgtcataggggtggtctttggcaccctaatcaaacgaaggcgacag
aagatccgcaagtacacgatgcggaggctgctgcaggaaacggagctggtggagcccctg
acgcccagcggggcgatgcctaatcaggctcagatgcgcatcttgaaagagacggagctg
aggaaggtgaaggtgcttggatctggcgcttttggcacagtctacaagggcatctggatc
cccgatggggaaaatgtgaaaattccagtggccatcaaggtgttgagggaaaacacgtcc
cccaaagccaacaaagaaatcttggacgaagcatatgtgatggctggtgtaggctccccg
tatgtgtcccgcctcctgggcatctgcctgacatccacggtgcagctggtgacacagctt
atgccctatggctgcctcctagaccacgtccgagaacaccgcgggcgcctgggctcccag
gacctgctgaactggtgtgtgcagattgccaagggcatgagctacttggaggacgtgcgg
cttgtgcacagggacctggctgcccgcaacgtgctggtcaagagtcccaaccatgtcaag
attacggacttcgggctggctcggctgctggacattgacgagacggagtaccatgcggat
gggggcaaggtgcccatcaagtggatggcattggagtccattctccgccggcggttcacc
caccagagtgatgtctggagctatggtgtgactgtgtgggagctgatgacttttggggcc
aaaccttatgatgggatcccagcccgggagattcctgacctgctggagaagggggaacgg
ctgcctcagccccccatctgcaccattgatgtctacatgatcatggtcaaatgttggatg
attgactctgaatgtcggccgaggttccgggagttggtggccgaattctcccggatggcc
agggacccccagcgctttgtggtcatccagaatgaggacttgggcccggccagccccttg
gacagcaccttctaccgctcgctgctggaggatgacgacatgggggacctggtggatgct
gaggagtacctggtaccccagcagggcttcttctgcccagaccctgccccgggcgctggg
ggcacagcccaccgcaggcaccgcagcacatccaccaggagtggcggtggtgagctgacg
ctggggctggaggcctctgaggaggagccccccaagtctccactggcaccttccgaaggg
gccggctctgacgtgttcgacggcgacctgggcatgggggcagccaaggggctgcagaac
ctcccccaacacgactctagccctctacagcggtacagtgaggaccccacagtacccctg
cctcctgaaactgatggctacgttgcccccctgacctgcagcccccagcccgaatacgtg
aaccagccggaggttcggccacagcccccctcgcccctagagggtcctctgcctcctcct
cgacctactggagccaccctggaaaggcccaagacgctctcccctggaaggaacggggtt
gtcaaggacgtttttgcctttggtgctgcagtggagaatccagagtacttggcaccccgg
ggcagggctccctctcagaaccacccttctccggccttcagcccagcctttgacaacctc
tattactgggaccaggacccatcagaccggggcgctctacccagcacctttgaagggacc
ccgactgcagagaaccccgaatacctgggtctggatgtgccagtatga

DBGET integrated database retrieval system