KEGG   Sus scrofa (pig): 100516830
Entry
100516830         CDS       T01009                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X2
  KO
K09850  Ras association domain-containing protein 1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04014  Ras signaling pathway
ssc04390  Hippo signaling pathway
ssc04392  Hippo signaling pathway - multiple species
ssc05200  Pathways in cancer
ssc05206  MicroRNAs in cancer
ssc05219  Bladder cancer
ssc05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100516830 (RASSF1)
   04390 Hippo signaling pathway
    100516830 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    100516830 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100516830 (RASSF1)
   05206 MicroRNAs in cancer
    100516830 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    100516830 (RASSF1)
   05223 Non-small cell lung cancer
    100516830 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH DUF5111 Mst1_SARAH
Other DBs
NCBI-GeneID: 100516830
NCBI-ProteinID: XP_003358497
Ensembl: ENSSSCG00000011407
LinkDB
Position
13
AA seq 272 aa
MGEADAGTPSFEMTWSSTTSSGYCSQEDSDSELEQYFTARTSLARRPRRDQDEPVEWETP
DLSQAEIEQKIKEYNSQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSKKPPSLQDA
RRGPGRGTAVKRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVVDDPRKFALFERA
ERHGQVYLRKLSDDEQPLRLRLLAGPSEKALSFVLKENDSGEVNWDAFSMPELHNFLRIL
QREEEEHLRQILKKYSYCRQKIQEALHACPLG
NT seq 819 nt   +upstreamnt  +downstreamnt
atgggtgaggcggacgcggggacgccttctttcgagatgacctggagcagcacgacaagc
agtggctactgcagccaggaggactcggactcagagctcgagcagtacttcaccgcgcgt
acctcgctggctcggaggccgcgccgggaccaggatgagcccgtggagtgggagacacct
gacctttctcaggctgagattgagcagaagatcaaggagtacaacagccagatcaacagc
aacctgttcatgagccttaacaaagacggctcctatacaggcttcatcaaggttcagctg
aagctggtgcgtcctgtatccgttccctccagcaagaagccaccctccttgcaggatgcc
cggcggggcccagggcggggcacagctgtgaaacgccgtacctccttctacctgcctaag
gatgctgtcaagcacctgcatgtgttgtcacgcacccgggcacgtgaagtcatcgaggcc
ctgctgcgcaagttcttggtggtagatgatccccgcaagtttgcgctctttgagcgggct
gagcgccatggccaagtgtacctccggaagctatcagatgatgagcagccccttcggctc
cggctcctcgcagggcccagtgagaaggccctaagctttgtcctgaaagaaaatgactct
ggggaggtgaactgggatgctttcagcatgcctgaactacacaacttcctacgcatcctg
cagcgggaagaagaggaacacctccgccagatcctgaagaagtactcctattgccgccag
aagatccaggaagccctgcatgcctgccccctggggtga

DBGET integrated database retrieval system