KEGG   Sus scrofa (pig): 100516888
Entry
100516888         CDS       T01009                                 

Gene name
GLI3
Definition
(RefSeq) transcriptional activator GLI3 isoform X1
  KO
K06230  zinc finger protein GLI3
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04024  cAMP signaling pathway
ssc04340  Hedgehog signaling pathway
ssc05200  Pathways in cancer
ssc05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100516888 (GLI3)
   04024 cAMP signaling pathway
    100516888 (GLI3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100516888 (GLI3)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100516888 (GLI3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    100516888 (GLI3)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    100516888 (GLI3)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4 IL17
Other DBs
NCBI-GeneID: 100516888
NCBI-ProteinID: XP_020934602
LinkDB
Position
18
AA seq 1586 aa
MEAQSHSSTTTEKKKVENSIVKCSPRADVSEKAVASSTTSNEDESPGQTYHRERRNAVAM
QPQSVQGLGKVSEEPSTSSDERASLIKKEIHGSLPHLAEPSVPYRGAVFAMDPRNGYMEP
HYHPPHLFPAFHPPVPIDARHHEGRYHYDPSPVPPLHVPSALSSSPAYSDLPLFRISPHR
NPAAASESPFSPPHPYVNPYMDYIRSLHSSPSLSMISAARGLSPTDAPHAGVSPAEYYHQ
MALLAGQRSPYADIIPSAATAGAGAIHMEYLHAMDGTRFPSPRLSARPSRKRTLSISPLS
DHSFDLQTMIRTSPNSLVTILNNSRSSSSASGSYGHLSASAISPALSFTYPSAPVSLHMH
QQILSRQQSLGSAFGHSPPLIHPAPTFPTQRPIPGIPTVLNPVQVSSGPSESSQSKPTSE
SAVSSTGDLVHNKRSKIKPDEDLPSPGPRGPQEQPEGTTLVKEEGDKDESKQEPEVIYET
NCHWEGCSREFDTQEQLVHHINNDHIHGEKKEFVCRWLDCSREQKPFKAQYMLVVHMRRH
TGEKPHKCTFEGCTKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRT
HSNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHVTKKQRGDVHPRPPPPRDSGGHS
QARSPGRPTQGALGEQKDLSSTTSKREECLQVKAVKAEKPMTSQPSPGGQSSCSSQQSPI
SNYSNSGLELPLTDGGAVGDLSAIDETPIMDSTISTATTALALQARRNPAGTKWMEHVKL
ERLKQVNGLLPRLNPIPPPKAPVVSPLIGHSTQPGTSCSLGGPAPLLPNRSDLSGVDLTV
LNVLDRRDSSTSTVSSAYLSSRRSSGISPCFSSRRSSEASQAEGRPQNVSVADSYDPIST
DASRRSSEASQGDGLPGLLSLTPAQQYRLKAKYAAATGGPPPTPLPNMERMSLKTRMALL
GEGREPAGTLPPVHPPRRCSDGGAHGHSRRPLLPQDALGIGVRRASDPVRTVSESLSLPR
GQRFNSLHSFNPPGLAPALEKRHLVLQNYTRPEGGPARHFRASPCPPSISENVTMESLTL
GATVDLNDEDLLPDDVVQYLHSQNQAGYEQPFPSALSDDGKVPHGPSLGSGPHDFDPLGL
PDSHAGHTGQQYRGLEPPCADASKPDLPIQWNEVSSGSADLSSSKLKCGQRPAAQQARAF
GLYSSTGVHPQNSLRSGAGPAGGYPTLGEHGSAFGGPEPLVSHSGGAGTNGNAFHEQPCK
AQQYGNCLARQPGAPSLLDAGIQAAKLRSSMQGSGGQPDFGLLVAPNESAGSPGNGMPTQ
DPVGQGYLAHQLLGDSMHPQGPGRPAQHTLGQGSATSHLHVYQGPEGGLPGPPNIGGQLS
GVAGIRGYQPCAGYGGSRRQAGPRGSLALPPSGQLSDTSQTCRVNGIKTEMPGPSHPLCS
NVQSFSGQFYDRPVGFSQQDTKTGCFSISEANCLLQGASAETSELLSPGANQVTSTVDSL
DSHDLEGVQIDFDAILEDADHASLMSGALSPSIIQNLSHSSSRLTTPRAALPLPALPASS
TNMAIGDMSSLLTSLAEESKFLAVMQ
NT seq 4761 nt   +upstreamnt  +downstreamnt
atggaagcccagtcccacagctccacgaccactgagaagaagaaagtggagaattccata
gtgaaatgctccccccgagcagatgtcagcgagaaagccgtggcctccagcaccacttcc
aacgaggatgaaagtcctggacagacgtatcaccgagagcgaagaaacgcggtcgccatg
cagccacagagcgtccaggggctcggcaaggtcagcgaggagccctcgacttccagcgac
gagagggcctcgctgatcaagaaggagatccatgggtccctgccgcacctggccgagccc
tccgtcccgtaccgcggggccgtgtttgccatggacccccgcaacggctacatggagcct
cactaccaccctccccacctcttccctgctttccaccctccggtccccatcgacgcgaga
caccacgagggccgttaccactacgatccgtctccggttcccccgctgcacgtgccttct
gccttgtccagcagccccgcgtattcagacctgcccttgttcaggatctccccgcatcgg
aaccccgccgcagcttccgagtcccccttcagcccgccgcacccctacgtcaacccttac
atggactacatccggtctctgcacagcagcccgtccctgtccatgatctcggccgcccgc
gggctgagccccacagacgccccccacgctggagtcagcccagcggaatactatcaccag
atggctctgttggccggccagcgcagcccctatgcagacatcatcccctccgctgccacc
gccggcgccggggccatccacatggagtatctccacgccatggatggcaccagattcccc
agccccaggctgtcagccaggccgagccgaaaacgcacactgtccatatcaccgctgtcg
gatcatagctttgaccttcagaccatgataaggacgtctcccaactccttggtcacgatt
ctcaataattcccgcagcagctcttcagcaagtggctcctatggccacttatctgcaagt
gcaatcagccccgccctgagcttcacctacccttctgcgcccgtctcgctccacatgcat
cagcagatcttgagccggcagcagagcttaggctccgcctttggacacagcccgccgctc
atccaccccgccccaaccttcccgacccagaggcccattcccgggatccccacggtcctg
aatcccgtccaggtcagctccggcccttccgagtcctcccagagcaagcccacgagtgag
tctgcggtgagcagcaccggcgacctcgtgcacaacaaacgctccaagattaagcccgac
gaagacctcccgagcccagggccgcggggcccacaggagcagccagaagggacgaccctg
gtgaaagaggaaggggacaaggacgaaagcaaacaggagcctgaagtcatctacgagaca
aactgccattgggaaggctgctcgcgggagttcgacacccaggagcagctggtgcatcat
ataaataacgaccatatccatggagagaagaaggagtttgtgtgccggtggctggattgc
tcgagggagcagaagcccttcaaagcccagtacatgctggtggtacatatgcgaaggcac
acgggcgagaagcctcacaaatgcacttttgaaggttgcacaaaggcctactcgagacta
gaaaacttgaaaacacacttgagatctcacaccggagagaaaccgtacgtctgtgaacac
gagggctgcaacaaggctttctccaacgcctccgatcgcgccaagcaccaaaacaggaca
cactccaacgagaaaccgtacgtgtgtaagatccccggctgcaccaagcgctacacggac
cccagctccctccgcaaacacgtgaagacggtgcacggcccggaggcgcatgtcaccaag
aagcagcgcggggacgtgcacccccggcccccgcccccgcgggactccggcggccactcg
caggccaggtcacccggccggccgacgcagggggccctcggggagcagaaggacctcagc
agcactacctcaaagcgggaagaatgcctccaagtgaaagccgtcaaggcggagaagccc
atgacatctcagccaagccctggtggtcagtcttcatgcagcagccaacagtcccccatc
agcaactattccaacagtggcctcgagcttcctctgaccgatggaggtgctgtgggcgac
ctcagcgccatcgatgaaacccccatcatggactcgaccatttccacggcaaccacagcc
ctggctttgcaagcccggaggaacccggcagggaccaaatggatggagcatgtcaaactg
gaaaggctcaaacaagtgaacggactgcttccacgactgaaccccattccaccccccaaa
gcccctgtggtctctcctctcataggacacagcacgcagccgggcaccagctgcagtctg
ggcgggcccgcgcccctgctcccgaacagaagcgacctttcgggcgtggacctcaccgtg
ctgaacgtgctcgaccggagagacagcagcaccagcaccgtcagctccgcctacctgagc
agccgccgctcctccggcatctccccctgcttctccagccgcaggtccagcgaggcgtcc
caggccgagggccggccccagaacgtgagcgtggccgactcgtacgaccccatctccacc
gacgcctcgcgcaggtccagcgaggccagccagggcgacggcctgcccggtctgctcagc
ctcacccccgcccagcagtaccgcctgaaagccaagtacgccgccgccacgggcggcccg
ccgcccaccccgctgcccaacatggagaggatgagcctcaagaccaggatggccctgctg
ggcgaaggcagggagcccgcggggacgctgcctcccgtgcaccctccccggaggtgcagc
gacggcggggcccacggtcacagccggcgccccctgctgccccaggacgcgctgggcatc
ggcgtgagaagggccagcgacccggtgaggaccgtctcggagagcctctccctgccccgg
gggcagcggttcaacagcctgcacagcttcaaccccccgggcttggcgcccgccctggaa
aagcgccacctggtgctgcagaactacacgcggcccgaggggggcccggcccgccacttc
cgcgcgtctccctgtcccccgagcattagcgagaatgtcaccatggagtccctgaccctg
ggcgccaccgtggacctgaacgatgaggacctcctgcctgacgacgtggtgcagtattta
cattcccagaaccaggcagggtacgagcagcccttccccagcgccctctccgacgacggc
aaagtgccccacgggcccagcttggggagcgggccccacgactttgacccactcgggctg
cccgacagccacgccggccacaccggccagcagtaccgggggctggagccgccctgcgcg
gatgccagtaaacccgacctgccgatccagtggaacgaagtcagctcgggcagcgccgac
ctgtcctcctccaagctcaagtgcggccagcgccccgcggcgcagcaggcccgagccttc
gggctgtacagcagcacgggcgtccacccgcagaattccctgaggagcggggctggcccg
gcgggggggtatccgacccttggggagcacggcagcgccttcggcggcccagagcccttg
gtgagccacagcggcggagctggtaccaacggaaacgccttccacgaacagccctgtaag
gcccagcagtatgggaactgcctcgccaggcagcccggcgcccccagcttgctcgatgcg
gggatccaggcggcgaagctgagaagcagcatgcaagggagcgggggccagccggatttt
ggcctgttggtggcgccgaatgagtccgctggcagccccgggaacggcatgcccacccaa
gacccggtgggacaggggtacctggcgcatcagctccttggcgacagcatgcacccccag
gggccaggccgccccgcgcagcacacgctagggcagggtagcgctacctcacacctccac
gtctaccaggggccggagggcggcctgcccgggccccccaacatcggcggccagctgtcc
ggcgtggcaggcatcaggggctaccagccgtgtgccggctacgggggcagccggcgccag
gctgggccgaggggcagcctggctctgccgccgtcgggacagctcagtgacacgagtcag
acctgcagggtgaacggcatcaagacggagatgccagggccgtcccacccgctctgttcc
aacgtgcagagtttctctggtcagttctatgaccgccccgttggcttcagtcagcaagac
acgaaaacgggttgcttctccatctccgaagccaactgcctgctccagggggccagcgcc
gaaacctccgagttactctccccaggtgctaaccaggtgacaagcacagttgacagcctc
gacagccatgacctggaaggggtgcagattgatttcgatgccatcctcgaggacgcggac
cacgccagcctgatgtcaggggcactgagcccgagcatcatccagaacctttctcacagc
tcctcccgcctcacgaccccgcgcgcggccctgccgctgcccgcgctgcccgccagcagc
accaacatggccattggggacatgagttcgctactgacctcccttgcagaagagagcaaa
ttcctcgcagttatgcagtag

KEGG   Sus scrofa (pig): 100520334
Entry
100520334         CDS       T01009                                 

Gene name
GLI2
Definition
(RefSeq) zinc finger protein GLI2
  KO
K16798  zinc finger protein GLI2
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04340  Hedgehog signaling pathway
ssc04390  Hippo signaling pathway
ssc05200  Pathways in cancer
ssc05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100520334 (GLI2)
   04390 Hippo signaling pathway
    100520334 (GLI2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100520334 (GLI2)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100520334 (GLI2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    100520334 (GLI2)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    100520334 (GLI2)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4
Other DBs
NCBI-GeneID: 100520334
NCBI-ProteinID: NP_001302641
Ensembl: ENSSSCG00000015733
UniProt: F1RXX4
LinkDB
Position
15
AA seq 1551 aa
MEASASVPAAEKKEAKSGILEGIAFPEPGRKASALAVAAAVAAQGVPQHLLPPFHAPLPL
DMRHQEGRYHYEPHSVHGVPGPPALSGSPVVSDISLIRLSPHPAGPGESPFNAPHPYVSP
HMEHYLRAMHGSPTLPAIPAARGLSPADVAHEHLKERGLFGLPAPGANASDYYHQMTLMA
GHPTPYGDLLMQSGGAASAPHLHDYLNPVDMSRFSSPRVTPRLSRKRALSISPLSDASLD
LQRMIRTSPNSLVAYINNSRSSSAASGSYGHLSAGALSPAFTFPHPINPVAYQQILSQQR
GLGSAFGHTPPLIQPSPTFLAQQPLAVASINATPTQLSSSSNCLSDANQNKQSSESAVSS
TINPMVIHKRSKVKTEAEGLRPASPLTLTQEQLADLKEDLDRDDCKQEAEVVIYETNCHW
EDCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRHTGEK
PHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNE
KPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHLRAPLLRENGDSEAGAE
PGRGSEDSTEASSTSQAVEDCLHVKAIKTESSGLCQSSPGAQSSCSSEPSPLGSAPNNDS
GVEMPGTGPGSLGDLTALDDTPPGADASALAAPSAGGLQLRKHMTAMHRFEQLKKEKLKS
LKDSCSWAGPAPHTRNSKLPPLPGSGSMLENFSGGPVGLLPNPRLSELSASEVTVLSHLQ
ERRDSSTSTVSSAYTVSRRSSGSSPYFSSRRSSDASPLGPGRANPASSADSYDPISTDAS
RRSSEASQCGGAGGPGLLQLTPAQQYSLRAKYAAATGGPPPTPLPGLERASLRARLALLD
APERAPPAACPRPVGVGLRRGSDGPHYGPTGVAPTFPHEGPGGGLRRASDPGRRPDALAP
PRVQRFHSAHNMAPAALPPTCTQGRGLRLQGHASADGGLARSAYSPRPPSISEDLVMEAV
AAAADSAGPEISLGLPEDDLVLPDDVVQYIKARAGGALEESTPQVYAPESTCFPENPKLP
SPGLPSQRRIAAADSNVGPSAPALGGCQLGYGAPSSLNKNSMPVQWNEVSSGTVDALASQ
MKPPPFPQGNLAVVQQKPAFSQYPGYSPQGLQPSPGSLDSSQPHLQPCGGAPSALRVNYM
HQLRQPGAGGQCPSMTAAVSPHTGYSQAHPQLSPSTMGGTLNQFPTSCSNMAAKPGHLGF
PQQMEVAPDPTMMGSNNRELGIPNSTLPGMPPTHAAQSYPQQSHLLATAMSQEGYRQGPS
LMPSHQPSFMEPQQGTMGVAGSSFGLVQPRPPPEPSPAGRHRGVRAGQQLAYARATGHAM
AALSANQEMAESVPKGTMLSLPPQPPAQDTGGAQDHSMLYYYGQIHMYEQNGGLERQAGC
QAMQPQPPQPQALPSPGVNQVSSTVDSQLLEAPQIDFDAIMDDGDHSSLLSGALSPGLLH
SLSQSSSRLTTPRNSLTLPSIPAGISNMAVGDMSSMLTSLAEESKFLNMIT
NT seq 4656 nt   +upstreamnt  +downstreamnt
atggaggcatctgcttcagtcccggctgcggagaagaaagaagccaagagtgggatcctg
gagggcatcgctttccctgagccgggcaggaaggcctctgcccttgcggtggccgccgca
gtagctgcccaaggagttccacagcatcttctgccaccgttccacgcccccttgccgctt
gacatgcgacaccaggaggggaggtaccattacgagccccattctgtccacggtgtaccc
gggcctcccgccctgagcggcagccccgtcgtctcagacatctcattgatccggctctcc
ccgcaccccgccggccctggggagtcccccttcaacgccccccacccgtacgtgagcccc
cacatggagcattacctccgcgccatgcacggcagccccacgctccccgccatccccgcg
gccaggggcctcagcccggcagacgtggcccacgagcaccttaaggagagggggctgttt
ggcctccctgctccaggcgccaacgcctcagactattaccaccagatgaccctcatggcg
ggccaccccacgccctatggggacctgctgatgcagagcgggggtgctgccagtgcaccg
catctccacgactacctcaatccagtggacatgtcgcgtttctccagcccccgggtgaca
ccccgcctgagccgcaagagggcgctgtccatctccccgctctccgacgccagcctggac
ctgcagcgcatgatccgaacctcgccaaactccctggtggcctacatcaacaattcgcgc
agcagctcagccgccagtggctcctatggccatctgtcggccggggccctcagcccggcc
ttcaccttcccgcaccccatcaaccccgtggcctaccagcagatcctgagtcagcagagg
ggcctgggctcagccttcggacacacaccacccttgatccagccctcacccaccttcctg
gcccagcagcccttggccgtggcctccatcaatgccacacccacccagctcagcagcagc
agcaactgtctgagcgacgccaaccagaacaagcagagcagcgagtcagccgtgagcagc
accatcaaccccatggtcattcacaagcgcagcaaggtcaagacagaggctgagggcctg
cggccagcctccccactgactctgacacaggagcagctggctgacctcaaggaagacctg
gacagggacgactgtaagcaggaggccgaggtggtcatctatgagaccaactgccattgg
gaagactgcaccaaggaatacgacacccaggagcagctggtgcatcacatcaacaacgag
cacatccacggggagaagaaggagttcgtgtgccgctggcaggcctgcacgcgggagcag
aagcccttcaaggcgcagtacatgctggtggtgcacatgcgcagacacacaggcgagaag
ccccacaagtgcacgttcgagggctgttccaaggcctactcccgcctggagaacctgaag
acgcacctgaggtcccacacaggagagaagccatacgtgtgtgagcacgagggctgcaac
aaggccttctccaacgcctcggaccgcgccaagcatcagaaccgcacccactccaacgag
aaaccctacatctgcaagatcccaggctgtaccaagcgatacacggaccccagctcactc
cggaaacacgtgaaaacggtccatggcccagatgctcacgtcaccaagaagcagcgcaat
gacgtgcacctccgcgcgcccctgctcagggagaacggggacagcgaggctggcgccgag
cccggccggggctccgaggacagcaccgaggccagcagcaccagccaggctgtggaggac
tgcctgcatgtcaaagccatcaagacggagagctccgggctgtgtcagtccagccccggg
gcccaatcttcctgcagcagtgagccctcacccctgggcagtgcccccaacaatgacagc
ggcgtggagatgccggggacagggcctgggagcctgggagacctgactgctctggatgac
acaccaccaggggccgatgcctccgccctggccgccccctctgccggtggcctgcagctg
cgcaaacacatgaccgccatgcaccggttcgagcagctcaagaaggagaagctcaagtcg
ctcaaggattcctgctcatgggccgggccagctccacacacccggaactccaagctgcct
cccctcccgggaagtggctccatgctggaaaacttcagcggcgggccggtggggctgctg
cccaacccgcgactgtcggagctgtccgccagcgaggtgactgtgctgagccacctgcag
gagcgccgcgacagctccaccagcacggtcagctcggcctacaccgtgagccgccgctct
tccggcagctccccctacttctccagccgccgctccagtgacgcctcacccctgggccct
ggccgcgcgaaccctgccagttctgccgactcctacgaccccatctccaccgatgcgtcg
cggcgctcgagcgaggccagccagtgcggcggtgctggtggcccagggctgctccagctc
acccccgcccagcagtacagcctgcgggccaagtacgcggcagccactggtgggccaccc
ccgacgccactgcccggcctggagcgcgcgagcctgcgggccaggctggcgctgctggat
gctccagagcgcgcgccgcccgccgcctgcccgcgcccagttggggtggggctgcggcgc
ggcagcgacgggccacactatggcccgacgggagtggcacccaccttcccccatgagggc
ccaggcggtgggctgcggcgggccagtgatcccgggaggcggcctgacgccttggcgccc
ccgcgggtccagcgcttccacagtgcccacaacatggccccggccgcgctgccaccaacg
tgcacccaggggcgaggcctccgccttcagggccacgcgagcgccgacggcggcctggcc
cgcagtgcctactcgccccggccgccgagcatcagcgaggacctggtgatggaggccgta
gcggcagcggcagacagcgcgggcccggagatcagtctcgggctgccagaggacgacctc
gtgcttcccgatgacgtggtgcagtacatcaaggcgcgtgcaggtggcgctctagaggag
agcaccccgcaagtgtacgccccggaaagcacctgcttccctgagaaccccaaactgccc
agcccagggctgcccagccagcgcaggatagcggccgcagactccaacgtgggcccctcc
gcccctgcgctgggaggctgccagctaggctacggggccccctccagcctgaacaagaac
agcatgcctgtgcagtggaacgaggtgagctccggcaccgtggacgccttggccagccag
atgaagcctcctcccttcccccagggtaacctggctgttgtgcagcagaagccggccttc
agccagtacccaggctacagtccgcaaggcctgcagccaagtcctgggagcctggacagc
tcacagccacaccttcagccctgtggtggggccccctcagcgctcagggtgaattacatg
caccaactgcggcagccaggggcaggtggccagtgtcccagcatgacagcggctgtgagc
ccccacaccggctacagccaagcccatccccagctgagccccagcaccatgggggggacc
ctgaaccagttccccacctcttgcagcaacatggcagccaagccaggccacctggggttc
ccccagcaaatggaggtggctcctgaccccaccatgatgggcagcaacaatagggaactt
gggatccccaattccaccctgcctgggatgccacccactcatgctgcacagagctacccc
cagcagagccatctcctggcaaccgccatgagccaggagggctaccgccaaggtcccagc
cttatgccttcccaccagcccagcttcatggagccccagcagggcacgatgggggtggct
ggatcaagctttggcctggtacaaccccggccaccaccggagcccagccctgctggccgc
caccgtggggtgcgtgctggacagcagctggcttatgccagggcgactggccatgccatg
gctgctctgtcagccaaccaggagatggcagagtctgtgcccaaaggtaccatgttgtcc
ctccccccacagccccccgcacaggacacaggcggggcccaggaccacagcatgctctac
tattacggccagatccatatgtacgagcagaatggaggcctagagagacaggcaggctgc
caggccatgcagccccagccaccgcagccccaggccttgccctcgcccggggtcaaccag
gtgtctagcacggtggactcccagctcctggaggccccccagattgattttgatgccatt
atggatgacggtgaccattccagcttgctctcgggcgccctgagccccggcctcctccac
agcctctcccagagctcctcgcgcctcaccacccctcggaactccctgacgctgccctcc
atccccgcgggcatcagcaacatggccgtcggggacatgagctccatgctcacgagcctg
gctgaggagagcaagttcctgaacatgatcacctaa

KEGG   Sus scrofa (pig): 100520490
Entry
100520490         CDS       T01009                                 

Gene name
GLI1
Definition
(RefSeq) zinc finger protein GLI1
  KO
K16797  zinc finger protein GLI1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04024  cAMP signaling pathway
ssc04340  Hedgehog signaling pathway
ssc05200  Pathways in cancer
ssc05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100520490 (GLI1)
   04024 cAMP signaling pathway
    100520490 (GLI1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100520490 (GLI1)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100520490 (GLI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    100520490 (GLI1)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    100520490 (GLI1)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4 zf-C2H2_8
Other DBs
NCBI-GeneID: 100520490
NCBI-ProteinID: NP_001243522
Ensembl: ENSSSCG00000000443
UniProt: H6WJF7
LinkDB
Position
5
AA seq 1106 aa
MFNSMTPPPVSSYGDPCCLRPLPSQGAPSMGTEGLPGVPFCHQATLMSGPHSYGPARETN
SCTEAPLFPPPRSAVKLTKKRALSISPLSDASLDLQTVIRTSPSSLVAFINSRCASPGGS
YGHLSIGTMSPSLGFSPQMNQQKGATPSFGVQPCGPHDPTPGGMMLHPQSRGPLPTCQLK
SELDVLVSKCPEEPLEGDMSSPNSTGTQDPLLGMLDGREDPEREEKPEPDSVYETDCRWD
GCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGEKP
HKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAKHQNRTHSNEK
PYVCKLPGCTKRYTDPSSLRKHVKTVHGPDAHVTKRHRGDGPLPRASALSTVEPKRERDG
GPVREESRLTVPEGAMKPQPSPGAQSSCSSDHSPAGSAANTDSGVEMTGNAGGSTEDLSS
LDEGPCIAGTGLSTLRRLENLRLDQLHQFRPVGPRGLKLPSLTHTGTPVSRRLGPPVSLD
RRSSSSSSVSSAYTVSRRSSLASPFPPGSPPENGASSLPGLTPAQHYLLRARYASARGGG
TPPTAAPSLDRMGGLPAPPWRSRAEYPGYNPNVGVTRRASDPARAADRPAPARVQRFKSL
GCVHTSPTVAGGGQNFDPHLPTSVYSPQPPSITENVTMDTRGLREKPEVGTSMMGSGLNP
YMDFPPADTLGYGGPEGAATESYGVRGPGSLPLGPGPPTNYGPNPCPQQVAYPEPTPETW
GEFPSHSGLYPGPKAPAGTYSQCPRLEHYGQVQVKPEQGCPVGSDSTGLAPCLNAHPNEG
PTCPQPLYSHYPQPPPPQYPQSGTYTQPPPDYLPSEPRPGLEFESPTHSTGQLKAQLVCN
YVQSQQELLWEGGGRGDPPVQEPLYQSSKFLGGSQVSPSPARAPVATYGPGFAPNLPSHK
SGSYPTPSPCHENFAVGANKASHRAAALPRLLPPLPTCYGPLKAGGTNPSCGHPEVGRLG
GGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEPQGLSPLPSHDQRDSSEHTPPPSGP
PNMAVGNMSVLLGSLPGETQFLNSSA
NT seq 3321 nt   +upstreamnt  +downstreamnt
atgttcaactcgatgaccccaccgccagtcagtagctatggcgatccctgctgtctccgg
cccctccccagtcagggggctcccagcatggggacagaaggactgcctggtgtgcccttc
tgccaccaggccaccctcatgtctggtccccacagttatgggccagctagagagaccaac
agctgcaccgaggccccactgtttcctcctccccggagtgcagtcaagttaaccaagaag
cgggccctctccatctcacctctgtcggacgccagcctggacctacagacagttatccga
acctcccccagctccctcgtggccttcatcaactcacgttgtgcatctccagggggctcc
tatggtcacctctccatcggcaccatgagcccatctttgggattctcacctcagatgaat
cagcaaaaaggggccacgccttccttcggggtccagccctgtggtccccatgaccccacc
ccaggggggatgatgctgcatcctcagtcccggggacccctcccaacttgccagctgaag
tctgagctggatgtgctggtgagcaagtgccccgaggagcccttggaaggtgatatgtcc
agccccaactccacgggcacacaggatcccctgttggggatgctagatgggcgcgaagat
ccagagagagaggagaagcctgaacctgactctgtgtatgagaccgattgccgctgggac
ggctgcagtcaggaatttgactcccaggagcagctggtgcaccacatcaacagcgaacac
atccatggagaacggaaggaattcgtgtgccattgggggggctgctccagggagctgagg
cccttcaaagcccagtacatgctggtggtgcacatgcgcaggcacacgggcgagaagcca
cacaagtgcacgtttgaggggtgccggaaatcatactcacgcctggaaaatctgaagaca
cacctgcggtcacacacgggtgagaagccatacatgtgtgagcatgagggctgcagtaaa
gccttcagcaacgccagtgaccgagccaagcaccagaatcggacccactccaatgagaag
ccgtatgtgtgtaagctccctggctgcaccaaacgctacacagatcccagctcgctccgg
aaacatgtcaagacagtgcacggtcctgatgcccacgtgaccaagcggcaccgaggagat
ggccccctgcctcgggcctcggctctttccacggtggagcctaagagggagcgggatgga
ggccccgtcagggaggagagcagactgactgtgccagagggtgccatgaagccacagccg
agtcctggagcccagtcctcctgcagcagtgaccactccccagcaggcagcgcggccaat
acagacagcggtgtggaaatgactggaaatgcaggaggcagcactgaggacctgtccagc
ttggacgagggaccttgtattgctggcactggtctgtctactcttcgccgccttgagaat
ctcaggctggaccaactacatcagttccggccagtggggccccggggcctcaaactgccc
agcttgacccacactggcactcccgtgtcccgccggctgggccccccagtttctcttgac
cgccgcagcagcagctccagcagtgtcagctcagcctatactgtcagtcgccgctcctcc
ttggcctctcctttcccccctggctccccaccagagaatggggcatcctctctgcctggc
ctcacacctgcccagcactacctgctccgggcaagatatgcttcagccaggggaggtggt
accccacccacagcagcacccagcctggatcggatggggggtctccctgcacctccctgg
agaagccgagccgagtatccaggatacaaccccaacgtaggggtcacccggagggccagt
gacccagcccgggctgctgaccgccctgccccagctagagtccagcggttcaagagcttg
ggttgtgtccacacatcccctacagtggcaggaggaggacagaacttcgatccccatctc
ccaacctctgtctactcaccacagccccccagcatcactgagaatgtcaccatggatacc
agagggctacgggagaagccagaggttgggacctccatgatgggcagtggtctgaaccct
tatatggatttcccacctgctgatactctgggatacgggggacctgagggggcagcaact
gagtcttacggagttagaggcccgggctccctgcctcttgggcctggtccacccaccaac
tatggccccaacccttgccctcagcaggtcgcctatcctgaacccaccccagaaacatgg
ggtgaattcccttcccactctggactgtacccaggccccaaggcgcctgctggaacctac
agccagtgtcctcgtcttgaacactatggacaagtgcaggtgaagccagaacaggggtgt
ccagtgggttctgactccacaggactggcaccctgcctcaatgcccaccccaatgagggg
cctacctgcccacagcctctatactcccactacccccagcctccccctccccagtacccc
cagtcaggcacctatacccagccacctcctgactatcttccttcagagcccaggcccggc
ctggagtttgagtcccctactcattctacaggacagctcaaggctcagcttgtgtgtaat
tatgttcagtctcaacaggaactgctgtgggagggcggtggaaggggagatcccccagtc
caggaacctctctaccagagttccaagtttctggggggttcccaggttagcccgagccct
gccagagccccagtggccacatacggacctggctttgcacctaacctgcccagtcacaag
tcaggctcctatcctaccccttcaccatgccatgaaaattttgcagtcggggcaaacaag
gcttcccacagggcagcagcactaccccgacttctgcccccgctacccacttgctacggg
cccctcaaggcagggggcaccaaccccagctgtggccatcccgaggtgggcaggctggga
gggggccctgccttgtaccctcctccggaagggcaggtgtgtaaccctctggactctctc
gatctcgacaacactcagctggactttgtggctattctggatgagccccaggggctgagt
cctctgccttctcatgatcagagggacagctctgaacacaccccacctccctcggggccc
cccaacatggctgtgggcaacatgagtgtcttattgggatccctacctggggagacacaa
tttctcaattccagtgcctga

DBGET integrated database retrieval system