KEGG   Sus scrofa (pig): 100517086
Entry
100517086         CDS       T01009                                 

Gene name
CSF1R
Definition
(RefSeq) macrophage colony-stimulating factor 1 receptor isoform X1
  KO
K05090  macrophage colony-stimulating factor 1 receptor [EC:2.7.10.1]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04010  MAPK signaling pathway
ssc04014  Ras signaling pathway
ssc04015  Rap1 signaling pathway
ssc04060  Cytokine-cytokine receptor interaction
ssc04061  Viral protein interaction with cytokine and cytokine receptor
ssc04151  PI3K-Akt signaling pathway
ssc04380  Osteoclast differentiation
ssc04640  Hematopoietic cell lineage
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100517086 (CSF1R)
   04014 Ras signaling pathway
    100517086 (CSF1R)
   04015 Rap1 signaling pathway
    100517086 (CSF1R)
   04151 PI3K-Akt signaling pathway
    100517086 (CSF1R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100517086 (CSF1R)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100517086 (CSF1R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100517086 (CSF1R)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100517086 (CSF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100517086 (CSF1R)
   05202 Transcriptional misregulation in cancer
    100517086 (CSF1R)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100517086 (CSF1R)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100517086 (CSF1R)
Protein kinases [BR:ssc01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100517086 (CSF1R)
CD molecules [BR:ssc04090]
 Proteins
  100517086 (CSF1R)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set Izumo-Ig Ig_6
Other DBs
NCBI-GeneID: 100517086
NCBI-ProteinID: XP_003124148
Ensembl: ENSSSCG00000014441
LinkDB
Position
2
AA seq 1053 aa
MGPKRLNVKGLAGQYFQTLWLPCLAERGRGGQPEEEEEEQSKTDSRSRERRASTRPGPCG
ARVPGPGSLATPSPASACRLPAGTMGLGTLLLLLAVTAWPGQGVPVIEPSGPELVVEPGA
AVTLRCVSNVSVEWDGPISRSWTLDPDAPSSALTTNNATFQNTGTYRCTELGDPLGGSAT
IHLYVKDHRRPWRVLAPEVTVLEGQDARLPCLLTDPALAGGVSLALLRRLSVLPGRAVLR
QTNYSFSPWHGFTIHKAKFIEGQDYACTVLVDGRVVWNSVRLNVQKVIPGPPTLTLKPTE
LVRIRGEAAQIVCSATDVDVHFEVFLHRGDTKLAISQQSDFHDNRYQKVLTLDLDPVGFQ
DAGNYTCMATNARGTHATSMVFRVVEGAYLTLTSEQSLRQEVAVGEKLDLKVKVEAYPSL
QSFNWTYQGPFSDQQPELSFETSKDTYRYASTLTLPRLKPSEAGRYSFLARNARGEGVLT
FELTLLYPPEVRITWSLVNGSRALVCQASGYPQPNVTWVWCGGHTDRCEGAGVLVQEALG
PEVLSQEPFHKATVQRLLAVGTLERNRTYECWARNSLGNSSHAFQPVSVAAQVHSPDEPL
FTPVLVACVSIMALLLLLLLLLLYKYKQKPKYQVRWKIIESFAGNSYTFIDPTQLPYSEK
WEFPRNKLQFGKTLGAGAFGKVVEATAFGLGQEDAVLKVAVKMLKSTAHADEKEALMSEL
KIMSHLGPHENTVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKAEAMLGPGLNPGQSPE
PGPGYKNIPLEKKYTRRDSGFSSQGVDAYVEMRPVSTSSSNDSFSEQDLDKEDGRPLELC
DLLRFSSQVAQGMAFLASKNCIHRDVAARNVLLTSGHVAKIGDFGLARDIMNDSNYIVKG
NARLPVKWMAPESIFDCVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNSKFYKLVKDGY
QMAQPAFAPKNIYSIMQACWALEPTRRPTFQQICSLLQEQSHGDQRARDYSNLPSSSSSS
SEPEEGSSGEHLACCEQGDAAQPLLQPNTYQFC
NT seq 3162 nt   +upstreamnt  +downstreamnt
atgggaccaaagagactgaatgtaaagggtttggctggccaatatttccaaactctgtgg
ttgccttgcctcgctgaaaggggaagagggggtcagcccgaggaggaggaagaagagcag
agcaagacagacagccggagccgggagaggcgcgcgtccactcgtcctgggccctgcgga
gctcgtgtcccgggccccgggtccctggccaccccaagccctgcatcagcctgccgcctg
cccgctgggaccatgggcctgggcacgctgctgctcctgctggcagtcacagcctggcct
ggtcagggggtcccggtgattgagcccagcggccctgagctggtggtggagccgggcgca
gctgtgaccttgcgatgcgtgagcaatgtcagcgtggagtgggacggccccatctcccgc
tcctggaccttggaccccgacgcccccagcagcgccctgaccacaaacaacgccaccttc
caaaacacgggcacgtaccgctgcaccgagctcggagacccgctggggggcagcgccacc
atccacctgtacgtcaaagaccatcgtcggccctggagggtcctggccccggaagtgacg
gtgctggagggccaggatgcgaggctgccctgcctgctcaccgacccggccctggcaggg
ggcgtctcgctggcactgctgcgcagactgtctgtcttgcccggccgggctgtcttgcgc
caaaccaactactccttctcgccctggcatggcttcactatccacaaggccaagttcatc
gagggccaggactacgcgtgcaccgtcctggtagacggcagggtggtgtggaacagcgtc
cggctcaacgtgcagaaagtcatcccaggccccccgaccttgacgctgaagcccacagag
ctggtgcgcattcggggagaggccgcccagatcgtgtgctcggccaccgacgtggatgtc
cacttcgaggtcttcctccaccgcggagacaccaagctggccatctctcaacaatccgac
ttccacgacaaccgttaccaaaaagtcctgaccctcgacctcgatcccgtgggcttccaa
gacgccggcaactacacctgcatggccaccaatgcccggggcacgcacgccacctccatg
gtcttccgggtggtagagggggcctacctgaccttgacctccgagcagagcctccgccag
gaggtagcagtgggagagaagctcgacctcaaagtcaaggtggaggcctacccgagcctg
cagagtttcaactggacctaccagggacccttctcggaccagcagcctgagctcagtttt
gaaaccagcaaggacacgtacagatacgcctccaccctcaccctgcctcgcctgaagccc
tccgaagccggccgctactccttcctggccagaaacgccagaggcgagggcgtcctgacc
tttgaactcacccttctgtacccaccggaggtcaggatcacgtggagcctcgtcaacggc
tccagagccctggtctgccaagcctcgggctacccgcagcccaacgtgacctgggtgtgg
tgtgggggccacacggacaggtgtgagggcgccggagtgctggtccaggaggccctcggc
cctgaggtcctgagccaggagcccttccacaaggcgactgtccagaggctgctggccgtt
gggaccttggagcgcaacaggacgtacgagtgctgggcccgcaacagcctgggcaacagc
tcccacgccttccagcccgtctccgtagcagcccaggtgcactcgccggatgaacccctc
ttcaccccggtgctggtggcctgtgtgtccatcatggccttgctgctgctgctgctcctg
ctgctcctttacaagtacaagcagaagcccaagtaccaggtgcgctggaagatcatcgag
agcttcgcgggcaacagctacacgttcatcgaccccacgcagctgccctacagcgagaag
tgggagttcccccggaacaagctgcagttcggtaagacgctgggagccggcgccttcggg
aaggtggtggaggccacagccttcggtctgggccaggaagacgctgtcctgaaggtggct
gtgaagatgctgaagtccacggcccacgctgacgagaaggaggccctcatgtcggagctg
aagatcatgagtcacctgggcccgcacgagaacacggtcaacctgctgggcgcctgtacc
cacggaggccctgtcctggtcatcaccgagtactgctgctacggggacctgctcaacttc
ctgcgaaggaaggcagaggccatgctgggacccggcctgaacccaggccagagccccgag
ccaggccccggctacaaaaacatccccttggaaaagaaatacacccgcagggacagcggc
ttctccagccagggtgtggacgcctacgtggagatgaggcccgtctccacgtcgtcttcc
aacgactcgttctctgagcaagacctggacaaggaggacggacggccgctggagctgtgc
gacctgctccgcttctcgagccaggtggcccagggcatggccttcctcgcttccaagaac
tgcatccaccgggacgtggcagcccggaatgtgctgctgaccagcggccacgtggccaag
attggggactttggtctggcaagggacatcatgaacgactccaactacattgtcaagggc
aacgcccgcctgcctgtgaagtggatggcccccgagagcatcttcgactgcgtctacacg
gtgcagagtgacgtctggtcctacggcatcctgctctgggagatcttctcgctggggctg
aacccctaccctggcatcctggtgaacagcaagttctacaagctggtgaaggacgggtac
cagatggcccagcctgcgttcgcccccaagaacatatacagcatcatgcaggcctgctgg
gccctggagccgacgcgcagacccaccttccagcagatctgctccctccttcaggagcag
agccacggcgaccagagagcgcgggactacagcaacctgccgagcagcagcagcagcagc
agcgagcccgaggaggggagctccggcgagcacctggcctgctgcgagcagggggatgcg
gcccagcccctgctgcaacccaacacctaccagttctgctga

DBGET integrated database retrieval system