KEGG   Sus scrofa (pig): 100517317
Entry
100517317         CDS       T01009                                 

Gene name
STK4
Definition
(RefSeq) serine/threonine-protein kinase 4 isoform X1
  KO
K04411  serine/threonine kinase 4
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04010  MAPK signaling pathway
ssc04014  Ras signaling pathway
ssc04068  FoxO signaling pathway
ssc05200  Pathways in cancer
ssc05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100517317 (STK4)
   04014 Ras signaling pathway
    100517317 (STK4)
   04068 FoxO signaling pathway
    100517317 (STK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100517317 (STK4)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    100517317 (STK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100517317 (STK4)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: STE group
  STE20 family
   100517317 (STK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Mst1_SARAH Pkinase_fungal Abi_2 Haspin_kinase DUF4611 Prothymosin
Other DBs
NCBI-GeneID: 100517317
NCBI-ProteinID: XP_020933518
Ensembl: ENSSSCG00000007386
LinkDB
Position
17
AA seq 487 aa
METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIKQ
VPVESDLQEIIKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKT
LTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK
RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNP
PPTFRKPELWSDSFMDFVKQCLVKSPEQRATATQLLQHPFVKSAKGVSILRDLINEAMDV
KLKRQEAQQREVDQDDEENSEEDEMDSGTMVRAAGDEMGTVRVASTMSDGANTMIEHDDT
LPSQLGTMVINAEEEEEEGTMKRRDETMQPARPSFLEYFEQKEKENQINSFGQSAPGPLK
NSSDWKVPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAK
KRRQQNF
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggagacggtgcagctgaggaacccgccgcgccggcagctgaaaaagttggatgaggat
agtttaactaaacaaccagaagaagtgtttgatgtcttggagaaacttggagaagggtcc
tatggcagcgtgtacaaagctattcataaagagaccggtcagattgttgctattaagcaa
gttcctgtggaatcggacctgcaggaaataatcaaagaaatctctataatgcagcaatgt
gacagccctcacgtagtcaaatattatggcagttattttaagaacacagacttgtggatt
gtgatggagtactgtggggctggttctgtgtccgatatcattcgattacgaaataaaacg
ttaacagaagatgaaatagctacaatattacaatcaacacttaagggactggaatacctt
cattttatgagaaaaatacatcgagatatcaaggcaggaaatattttgctaaatacagaa
ggacatgcaaaacttgcagattttggggtagcaggtcaacttacagataccatggccaaa
agaaatacagtgatagggacaccattttggatggctccagaagtgattcaggaaataggg
tacaactgtgtggcagacatctggtcactgggaatcactgccatagaaatggccgaagga
aagccgccgtatgccgatatccatccaatgagggcaatcttcatgattcctaccaaccca
cctcccacattccgaaagccagaactgtggtcagatagcttcatggattttgtgaagcag
tgtcttgtaaagagccctgagcagagagccacggccactcaactcctccagcacccattt
gtcaagagtgccaaaggagtgtccatactgcgggacttaattaacgaagccatggacgtg
aagctgaaacgccaggaagcccagcagcgggaggtggaccaggacgatgaagaaaactca
gaggaggatgaaatggattctggcacgatggtccgagccgccggggacgagatgggcacc
gtccgcgtggccagcaccatgagtgacggagccaataccatgatcgagcacgacgacacg
ttgccgtcccagctgggcaccatggtgatcaatgcggaggaggaggaagaggaaggcact
atgaaaagaagggatgagaccatgcagcctgcaagaccatctttcctcgaatactttgaa
caaaaagaaaaggaaaatcagatcaacagctttggccagagtgcccctggtccactgaag
aactcttcagattggaaagttccacaggatggagactatgaatttctcaagagctggaca
gtggaggaccttcagaagaggctcctggccctggaccccatgatggagcaggagattgag
gagatccggcagaagtaccagtcgaagcggcagccgatcctggatgccattgaggccaag
aagcggcggcagcagaacttctga

DBGET integrated database retrieval system