KEGG   Sus scrofa (pig): 100517932
Entry
100517932         CDS       T01009                                 

Gene name
APC
Definition
(RefSeq) adenomatous polyposis coli protein
  KO
K02085  adenomatosis polyposis coli protein
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04810  Regulation of actin cytoskeleton
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05206  MicroRNAs in cancer
ssc05210  Colorectal cancer
ssc05213  Endometrial cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100517932 (APC)
   04390 Hippo signaling pathway
    100517932 (APC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100517932 (APC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100517932 (APC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100517932 (APC)
   05206 MicroRNAs in cancer
    100517932 (APC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100517932 (APC)
   05225 Hepatocellular carcinoma
    100517932 (APC)
   05226 Gastric cancer
    100517932 (APC)
   05217 Basal cell carcinoma
    100517932 (APC)
   05213 Endometrial cancer
    100517932 (APC)
   05224 Breast cancer
    100517932 (APC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100517932 (APC)
   05022 Pathways of neurodegeneration - multiple diseases
    100517932 (APC)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100517932 (APC)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100517932 (APC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ssc01009]
    100517932 (APC)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ssc03036]
    100517932 (APC)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ssc04812]
    100517932 (APC)
Protein phosphatases and associated proteins [BR:ssc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100517932 (APC)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100517932 (APC)
Cytoskeleton proteins [BR:ssc04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     100517932 (APC)
SSDB
Motif
Pfam: Arm_APC_u3 APC_basic EB1_binding APC_r APC_u5 APC_u14 APC_rep APC_u15 APC_u9 SAMP APC_N_CC Arm APC_u13 APC_15aa Suppressor_APC JIP_LZII Sec7_N
Other DBs
NCBI-GeneID: 100517932
NCBI-ProteinID: NP_001193359
Ensembl: ENSSSCG00000014207
UniProt: F2X0U8
LinkDB
Position
2
AA seq 2847 aa
MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMKEVLKQLQGSIEDEAM
ASSGQIDLLERLKELNLDSSNFPGVKLRSKMSLRSYGSREGSVSSRSGECSPVPMGSFPR
RGFVNGSRENTSYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRIDSLPLTENFSL
QTDMTRRQLEYEARQIRVAMEEQLGTCQDMEKRAQRRITRIQQIEKDILRIRQLLQSQAT
EAERSSQSKHEAGSYEAERQNEGQGVAEISMATSGNGQGSSTRVDHETASVLSSSSTHSA
PRRLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQSGCLPLLIQLL
HGNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLLEQIRAYCETC
WEWQEAHEQGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELGGLQAIAELLQ
VDCEMYGLTNDHYSITLRRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDL
QQVIASVLRNLSWRADVNSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCT
ENKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNEEHRQILRENN
CLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWDMGAVSMLKNLIHSKHKMIAM
GSAAALRNLMANRPAKYKDANIMSPGSSLPSLHVRKQKALEAELDAQHLSETFDNIDNLS
PKASHRSKQRHKQNLYGDYAFDANRHDDNRSDNFNTGNMTVLSPYLNTTVLPSSSSSRGS
LDSSRSEKDRSLERERGISIGNYHPATENPGTSSKRGLQISTTAAQIAKVMEEVSAIHPS
QEDRNSGSTTELHCGTDERNALRRSSTAHSHANTYNFTKSENSNRTCPMPYAKVEYKRSS
NDSLNSVSSSDGYGKRGQMKPSIESYSEDDESKFCSYGQYPADLAHKIHSANHMDDNDGE
LDTPINYSLKYSDEQLNSGRQSPSQNERWARPKHIIEDEIKQNEQRQSRSQSTTYPVYPE
STDDKHLKFQPHFGQQECVSPYRSRAANGSEANRVGSNHGINQNVNQSLCQEDDYEDDKP
TNYSERYSEEEQHEEEERPTNYSIKYNEEKHHVDQPIDYSLKYATDIPSSQKPAFSFSKN
SSGQSTKTERISPSGENTSTPSSNAKRQSQLHPSSAQSRSGQTPKATSSSCKVPSINQET
IQTYCVEDTPICFSRCSSLSSLSSAEDEIGCDQQTQETDSANTLQIAEIKENSGTRSTEE
SVSEVPTVPQHIRTKSSRLQASGLSSESTRHKAVEFSSGAKSPSKSGAQTPKSPPEHYVQ
ETPLMFSRCTSVSSLDSFESRSIASSVQSEPCSGMVSGIISPSDLPDSPGQTMPPSRSKT
PPPPPPQTSQTKQEVPKSKAPSAEKRESGPKQAAVNAAVQRVQVLPDADTLLHFATESTP
DGFSCSSSLSALSLDEPFIQKDVELRIMPPVQENDNGNETENEQPEKSNENQEKEAEKPT
DSEKDLLDDSDDDDIEILEECIISAMPTKSSRKAKKPAQTASKLPPPVARKPSQLPVYKL
LPSQNRLQAQKHVSFTPGDDVPRVYCVEGTPINFSTATSLSDLTIESPPNELAAGEGARA
GAQSGEFEKRDTIPTEGRSTDEAQRGKSTSVAIPELDDNKTEEGDILAECINSAMPKGKS
HKPFRVKKIMDQVQQASMSSSGANKNQLDGKKKKPTSPVKPIPQNAEYRTRVRKNTDTKN
NLNAERAFSDNKDSKKQSLKNNSKDFNDKLPNNEDRVRGSFTFDSPHHYTPIEGTPYCFS
RNDSLSSLDFDDDDVDLSREKAELRKGKENKESEAKVSNHTELASNQQSAKTTQAVTKHP
INRGPSKPMLQKQSTFPQSSKDIPDRGAATDEKLQNFAIENTPVCFSRNSSLSSLSDIDQ
ENNNNKESEPIKETEPPHSQGEPSKPQASGYAPKSFHVEDTPVCFSRNSSLSSLSIDSED
DLLQECISSAMPKKKKPSRLKGDNEKHSPRNMSGILAEDLTLDLKDIQRPDSEHGLSPDS
ENFDWKAIQEGANSIVSSLHQAAAAACLSRQASSDSDSILSLKSGISLGSPFHLTPDQEE
KPFTSNKGPRILKPGEKSTLETKKMESENKGIKGGKKVYKSLITGKVRSNSEISSQMKQP
LQTNMPSISRGRTMIHIPGVRNSSSSTSPVSKKGPPLKTPASKSPSESQAATTSPRGAKP
SVKSELSPVTRQTSQTAGSNKGPSRSGSRDSTPSRPAQQPLSRPMQSPGRNSISPGRNGI
SPPNKLSQLPRTSSPSTASTKSSGSGKMSYTSPGRQMSQTNLTKQTGLSKNGSSIPRSES
ASKGLNQMSCSNGSNKKVELSRMSSTKSSGSESDRSERPVLVRQSTFIKEAPSPTLRRKL
EESASFESLSPSSRPDSPTRSQAQTPVLSPSLPDMSLSTHSSVQAGGWRKLPPNLSPTIE
YNDGRPIKRHDIARSHSESPSRLPINRSGTWKREHSKHSSSLPRVSTWRRTGSSSSILSA
SSESSEKAKSEDEKHVNSISGTKQTKESQVSTKGTWRKIKESEISPTNTTSQTTSSGAAN
GAESKTLIYQMAPAVSKTEDVWVRIEDCPINNPRSGRSPTGNTPPVIDTISEKGNPNAKD
SKDNQGKHNVSNGGAPTRTMGLENRLNSFIQVDAPDQKGTETKPGQSNSVPASETNESSI
AERTPFSSSSSSKHSSPSGTVAARVTPFNYNPSPRKSSADSTSARPSQIPTPVNNNTKKR
DSKTDNTDSSGTQSPKRHSGSYLVTSV
NT seq 8544 nt   +upstreamnt  +downstreamnt
atggctgcagcttcatatgatcagttgttaaagcaagttgaggcactgaagatggagaac
tcaaatcttcgacaagagctagaagataattccaatcatcttacaaaactggaaactgag
gcatctaatatgaaggaagtacttaaacagctacaaggaagtattgaagatgaagctatg
gcttcttctggacagattgatttattagagcgcctcaaagaacttaacttagatagcagt
aatttccctggagtgaaactacggtcaaaaatgtccctccgttcttacggaagccgagaa
ggatctgtatctagtcgttcaggagagtgcagtcctgttccaatgggttcatttccaaga
agagggtttgtaaatggaagcagagaaaataccagttatttagaagaacttgaaaaagag
aggtcattacttcttgctgaccttgacaaagaagaaaaggaaaaagactggtattatgct
caacttcaaaatctcactaaaagaattgatagtcttcctttaactgaaaatttttcctta
cagacagatatgaccagacggcaattggaatatgaagcaaggcaaatcagagttgcaatg
gaagaacagctaggtacctgccaggatatggaaaaacgagcacagcgaagaataaccaga
attcaacaaatagagaaggacatacttcgtatacgacagcttttacagtcccaagcaaca
gaagcagagaggtcatctcagagcaagcatgaagctggctcatatgaagctgagcggcag
aatgaaggtcaaggagtggcagaaatcagtatggcaacttcgggtaacggtcagggttcg
agtacacgagtagatcacgaaacagccagtgttttgagttctagtagcacacactctgct
cctcgaaggctgacaagtcatctgggaaccaaggtggaaatggtgtattcattgttgtca
atgcttggtactcatgataaggatgatatgtcgcgaactttgctagctatgtctagctcc
caagacagctgtatatccatgcgacagtctggatgtcttcctctcctcatccagctttta
catggcaatgacaaagactctgtgttgttgggaaattcccggggcagtaaagaggctcgg
gccagggccagtgcagcactccacaacatcattcactcacagcctgatgacaagagaggc
aggcgtgaaatccgagtccttcatcttttggaacagatacgagcttactgtgaaacctgt
tgggagtggcaggaagcccatgaacaaggcatggaccaggacaaaaatccaatgccagct
cctgttgaacatcagatctgtcctgctgtgtgtgttttaatgaaactttcattcgatgaa
gagcacagacatgcaatgaatgaactagggggactacaggccattgcagaattattgcaa
gtggactgtgaaatgtatgggcttactaatgaccactacagtattactttaagacgatat
gcaggaatggctttgacaaatttgactttcggagatgtagccaacaaggctacactatgc
tcgatgaaaggctgcatgagagcacttgtggcccaactaaaatctgaaagtgaggactta
cagcaggtcattgcaagtgttttgaggaatttgtcttggagagcagatgtaaatagtaaa
aagacattgcgtgaagttggcagtgtgaaagcattgatggaatgtgctttggaagtgaaa
aaggaatcaaccctcaaaagcgtgttgagtgccttatggaatttgtcagcacattgcact
gagaataaggctgatatatgtgccgtagatggtgcgcttgcgtttttggttggcactctc
acttaccggagccagacaaatactttagccattattgaaagtggaggtgggatattacgg
aatgtgtccagcttgatagctacaaatgaagagcacaggcaaatcctaagagagaacaat
tgcttacaaaccttattacaacacttgaaatctcacagtttgacaatagtcagtaatgca
tgtggaaccttgtggaatctctcagccagaaatcctaaagaccaggaagcattatgggac
atgggggcagtcagcatgctcaagaacctcattcattcaaagcacaaaatgattgctatg
gggagcgccgcagctttaaggaatctgatggcaaatagacctgcaaagtataaagatgcc
aatatcatgtctcctggttcaagcttgccttctcttcatgtcaggaaacaaaaagcccta
gaagcagaattagacgcccagcatttatcagaaacttttgacaatattgacaatttaagt
cccaaggcatctcatcgtagtaagcaaagacacaagcaaaatctctacggtgactatgct
tttgatgccaatcgacatgacgataataggtcagacaattttaatactggaaacatgact
gtcctgtcaccatatttaaatactacagtgttgcccagctcctcttcatcaaggggaagt
ttagatagttctcgttctgagaaagacagaagtttggagagagaacgaggtattagcata
ggcaactaccatccagcaacagaaaatccaggaacctcttcaaagcgaggtttgcagatt
tccaccactgcagcccagatcgccaaagtcatggaagaagtatcagccattcatccctcc
caggaagacagaaattctgggtcaaccacggagttgcactgtgggacagatgagaggaat
gcactgagaagaagctctactgcccactcacacgcaaacacgtacaacttcaccaagtca
gaaaactcaaacaggacatgtccaatgccatatgccaaagtagaatataagagatcttca
aatgatagtttaaatagtgtcagtagtagtgatggttatggtaaaagaggccagatgaaa
ccttcaattgaatcctattctgaagacgatgaaagtaaattttgcagctatggtcagtat
ccagctgacctagcccataaaatacatagtgcaaatcatatggatgataatgatggagaa
ctagatacaccaataaattacagtcttaaatattcagatgaacagctgaactccggaagg
caaagtccttcacagaatgaaaggtgggcaagacccaaacatataatagaagatgaaata
aaacaaaatgagcaaagacaatcaaggagtcaaagcacaacttatcctgtgtatcctgag
agcactgatgataaacacctcaagtttcagccgcattttggacagcaagaatgtgtttcc
ccatataggtcaagagcagccaatggttcagaagcaaatcgagtaggttctaatcatgga
attaatcaaaatgtaaaccagtctttgtgtcaggaagatgactatgaagatgataagcca
accaactacagtgaacgttactctgaggaggagcaacatgaggaagaagagagaccaacc
aattatagcataaaatacaatgaagaaaaacatcatgtggatcagcctattgattatagt
ttaaaatatgccacagacatcccttcttcacagaaaccagcattttcattctcaaagaat
tcatctggacaaagtactaaaactgaacgcatctctccaagcggtgagaacacatccaca
ccttcctctaatgccaagaggcagagccagctccatccaagttcagcacaaagcagaagt
ggtcagaccccaaaagccacctcctcctcttgcaaagttccctctatcaaccaagaaacc
atacagacttactgtgtagaagataccccaatatgtttttcaaggtgtagttcattatcg
tctttgtcatcagccgaagatgaaatagggtgtgatcagcaaacgcaggaaacagattct
gctaatactctacaaatagccgaaatcaaagaaaacagtggaaccagatcaactgaagag
tctgtgagcgaagttccaacagtgccacagcacattagaaccaaatccagcagactccag
gcttctggcttatcttcagaatcaaccaggcacaaagctgttgaattttcttcaggggcc
aaatctccatcaaagagtggtgctcagacacctaaaagtccaccagagcactacgttcag
gagactccactcatgttcagcagatgtacctctgtcagctcacttgacagttttgagagt
cgttccattgccagctccgttcagagtgagccctgcagtggaatggtgagtggcattata
agccccagtgaccttccagatagcccaggacaaaccatgccaccaagcagaagtaaaacc
cctccccctccccctcctcaaacaagtcaaaccaagcaggaagtacctaaaagtaaagca
cctagtgctgaaaagagagaaagtggacctaagcaagctgctgtgaatgctgcagtacaa
agggtccaggttcttccagatgctgatactttgttacattttgctacagaaagtactccg
gatggattttcttgttcatctagcctgagtgccctgagcctcgatgagccatttattcag
aaagatgtggaattaagaataatgcctccagttcaggaaaatgacaatggcaatgaaaca
gaaaatgagcagcctgaaaaatcaaatgaaaaccaggaaaaagaggcagaaaagcccact
gattctgaaaaagacctattagatgattcagatgatgatgatattgaaattctagaagag
tgtattatttctgccatgccaacaaaatcttcacgcaaagcaaaaaagccagcccagact
gcttcaaaattacctccacctgtggcaagaaaaccaagtcaactgcctgtgtacaaactt
ctgccctcacaaaacaggttacaagcacaaaagcatgttagttttacaccaggagatgat
gtgccacgtgtgtattgtgtagaagggacacctataaacttttccacagctacatctcta
agtgatctaacaatagaatcccccccaaatgagttggctgctggagaaggggccagagca
ggggcacagtcaggtgaatttgaaaaacgagacaccattcctacagaaggcagaagtaca
gatgaggctcaaagagggaaatccacatctgtagctatacctgaactggatgacaataaa
acagaagaaggtgatatccttgcagaatgcattaattctgctatgcccaaaggaaaaagt
cacaagcctttccgtgtgaaaaagataatggaccaggtccagcaagcatctatgtcctca
tccggagctaacaaaaatcaattagatggtaagaaaaagaaacctacttcaccagtaaaa
cccataccacaaaatgctgaatataggacgcgtgtaagaaaaaatacagacacgaaaaat
aatttaaatgctgaaagagctttctcagacaataaagattcaaagaaacagagcttgaaa
aataattccaaggacttcaacgataagctgccaaataatgaagatagagtcagaggaagc
tttacttttgattcacctcatcactacacacctattgaaggcactccgtactgtttttca
cgaaatgattctttgagttctctagattttgatgatgatgatgttgacctttcgagggaa
aaggctgaattaagaaaggggaaggaaaacaaggaatcagaagctaaggttagcaaccac
acagaactagcctcgaaccaacaatcagctaagacgacacaggctgttacaaaacatcca
ataaatcgaggtccgtctaaacctatgctgcagaagcagtccacttttccccagtcctcc
aaagatataccagacagaggggcagcaactgatgagaaattacaaaattttgctattgaa
aatactccagtttgcttttctcgaaattcctctctaagttctcttagtgacattgatcag
gaaaacaacaacaacaaggaaagtgaacctatcaaagagacagagcctcctcattcccag
ggagaaccaagtaaacctcaggcatcaggttatgctcctaaatcatttcatgttgaagat
acccctgtttgtttctcaagaaacagttctctcagttctctcagtatcgattctgaagat
gacctattgcaggaatgtataagttctgccatgccaaaaaagaaaaagccttcaagactc
aagggtgataatgaaaagcatagtcccagaaacatgagtggcatattagcagaagatttg
acgcttgatttgaaagatatacagagaccagattcagaacatggtttatcccccgattca
gaaaattttgattggaaagctattcaggaaggtgcaaattccatagtaagtagtttacat
caagctgctgctgccgcatgtttatctagacaggcttcgtctgattcagattccatcctg
tccctgaaatcaggaatctccctggggtcaccatttcatcttacacctgatcaagaggaa
aaaccctttacaagtaataaaggcccacgaattctaaaacctggagagaaaagtacactg
gaaactaaaaagatggaatctgaaaataagggaataaagggagggaaaaaggtttataaa
agtttgattactggaaaagttcgatctaattcagaaatttcaagccaaatgaaacagcct
cttcaaacaaacatgccttcaatctctcgaggtaggacaatgattcacattccaggagtt
cggaatagctcttcaagtaccagtccagtttctaaaaaaggtccaccgctgaagactcca
gcctccaaaagccctagtgaaagtcaggcggctaccacttctcccagaggagcaaagccc
tcagtgaaatcagaattaagccctgttaccaggcagacatcgcagacagctgggtccaat
aaagggccttctagatcaggatctagagattccactccttcaagacctgcccagcaacca
ctcagtaggcctatgcagtctccagggagaaactcgatttctcctggtagaaatggaata
agtcctcctaacaaattatctcaactaccaaggacgtcatcccctagtactgcttcaact
aagtcctcaggttcggggaaaatgtcttacacatctccaggcagacagatgagccagaca
aaccttaccaaacaaacaggtttatccaagaatggcagcagtatcccaagaagtgagtct
gcctccaaagggctaaatcaaatgagttgtagcaatggatccaataaaaaggtagaactt
tctagaatgtcctcaactaaatcaagtggaagtgaatctgatagatcagagagacctgtg
ttagtacgccagtcaactttcatcaaagaagctccaagtccaaccctgaggagaaaactg
gaggaatctgcttcgtttgaatctctttctccatcttctcgaccagattctcccactcgg
tcccaggcacagactccagttttaagtccttctcttcctgatatgtctctgtccacacat
tcgtccgttcaggctggtgggtggcgaaaactcccacctaatctcagtcccaccatcgag
tataatgacggaagaccaataaagcgccatgatatagcacgctcccactctgaaagtcct
tccagacttcccatcaataggtcaggaacctggaaacgtgagcacagcaaacactcatca
tcccttcctcgagtaagcacttggagaagaactggaagttcatcctcaattctttcggct
tcatcagagtccagtgaaaaggcaaaaagtgaggatgaaaaacatgtgaactctatctcg
ggaaccaaacaaactaaagaaagccaagtatccacaaaaggaacatggaggaaaataaaa
gaaagtgaaatttctcccacaaatactacttctcagaccacttcctcaggtgctgcaaac
ggtgctgaatccaagactctaatttatcaaatggcacctgctgtttctaaaacagaggat
gtttgggtgagaatcgaggactgtcccattaacaaccccagatctggaagatctccaaca
ggaaataccccccctgtgattgacaccatttcagaaaaaggaaacccaaacgctaaagat
tcaaaagataatcagggaaaacacaatgtgagtaatggtggtgctcccacacgcaccatg
ggtttggaaaaccgcctgaactcctttattcaggtcgatgccccagaccaaaaaggaact
gagacaaaaccgggacaaagcaactctgtccctgcatcagagactaacgaaagttctata
gctgagcgtaccccatttagttctagcagctcaagcaagcacagttcacccagtgggacc
gttgctgccagagtgactccttttaattacaacccaagccctaggaaaagcagcgcagat
agcacttcagcccgaccatctcagatcccgacgccggtgaataacaacacgaagaaacga
gattcaaaaactgacaacacagactccagtggaactcaaagtcctaaacgccattctggg
tcttaccttgtgacgtctgtttaa

KEGG   Sus scrofa (pig): 100579172
Entry
100579172         CDS       T01009                                 

Gene name
APC2
Definition
(RefSeq) adenomatous polyposis coli protein 2
  KO
K02085  adenomatosis polyposis coli protein
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04310  Wnt signaling pathway
ssc04390  Hippo signaling pathway
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04810  Regulation of actin cytoskeleton
ssc04934  Cushing syndrome
ssc05010  Alzheimer disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05165  Human papillomavirus infection
ssc05200  Pathways in cancer
ssc05206  MicroRNAs in cancer
ssc05210  Colorectal cancer
ssc05213  Endometrial cancer
ssc05217  Basal cell carcinoma
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100579172 (APC2)
   04390 Hippo signaling pathway
    100579172 (APC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100579172 (APC2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100579172 (APC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100579172 (APC2)
   05206 MicroRNAs in cancer
    100579172 (APC2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100579172 (APC2)
   05225 Hepatocellular carcinoma
    100579172 (APC2)
   05226 Gastric cancer
    100579172 (APC2)
   05217 Basal cell carcinoma
    100579172 (APC2)
   05213 Endometrial cancer
    100579172 (APC2)
   05224 Breast cancer
    100579172 (APC2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100579172 (APC2)
   05022 Pathways of neurodegeneration - multiple diseases
    100579172 (APC2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100579172 (APC2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100579172 (APC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ssc01009]
    100579172 (APC2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ssc03036]
    100579172 (APC2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ssc04812]
    100579172 (APC2)
Protein phosphatases and associated proteins [BR:ssc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100579172 (APC2)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100579172 (APC2)
Cytoskeleton proteins [BR:ssc04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     100579172 (APC2)
SSDB
Motif
Pfam: APC_basic APC_rep APC_N_CC Arm_APC_u3 Suppressor_APC Arm APC_r SAMP bZIP_1 HALZ Sec2p Herpes_BLRF2
Other DBs
NCBI-GeneID: 100579172
NCBI-ProteinID: NP_001193360
Ensembl: ENSSSCG00000023329
UniProt: F2X0U7
LinkDB
Position
2
AA seq 2265 aa
MTSSMAPYEQLVRQVEALKAENSHLRQELRDNSSHLSKLENETSGMKEVLKHLQGKLEQE
ARALVSSGQTEVLEQLKALQMDITSLYNLKFQPPALAPEPAARTPDGSPVHSSGPSKDNF
GELSRATIRLLEELDRERCFLLNEIEKEEKEKLWYYSQLQGLSKRLDELPHVETQFSMQM
DLIRQQLEFEAQHIRSLMEERFGTSDEMVQRAQIRASRLEQIDKELLSAQDRVQQTEPQA
LLAVKSVPMDEDPETEVPTHPEDGAPQPGNSKVEVVFWLLSMLATRDQEDTARTLLAMSS
SPESCVAMRRSGCLPLLLQILHGTEAGVGGRNGAPGAPGAKDARMRANAALHNIVFSQPD
QGLARKEMRVLHVLEQIRAYCETCWDWLQTRNSGPEGAGAGSAPIPIEPQICQATCAVMK
LSFDEEYRRAMNELGGLQAVAELLQVDYEMHKMTRDPLNLALRRYAGMTLTNLTFGDVAN
KATLCARRGCMEAIVAQLASESEELHQVVSSILRNLSWRADINSKKVLREVGSMTALMQC
VLRASKESTLKSVLSALWNLSAHSTENKAAICQVDGALGFLVSTLTYKCQSNSLAIIESG
GGILRNVSSLIATREDYRQVLRDHNCLQTLLQHLTSHSLTIVSNACGTLWNLSARSPRDQ
ELLWDLGAVGMLRNLVHSKHKMIAMGSAAALRNLLAHRPAKYQAAATAISPGACVPSLYV
RKQRALEAELDARHLAQALDHLEKQGLPEAEAASKKPLPPLRHLDGLAQDYASDSGCFDD
DDAPSLAAAAATATAEPASPAMLSLFLGSPFLQGQALARAPTARRGGLETEKETGGEAAV
AARAKAKLALAVARIDRLVEDISALHTSSDDSFSLSSGDPGQEAPREGRAQSCSPCRGPD
GGRREASSRAHPLLRLKAGHTSLSNDSLNSGSTSDGHCPREHSRPCPLVTLAEHREGPPC
GQARPSRLDLGLANGKPEPAARDTTATDAHVRTIKLSPTYQHVPLLEGTTRVGAGSLAPG
ARKQAWLPTEGLSKAPEKLAVETAPLSLSHCSSLSSLSSAGRPGPSEAGDLDDSDSSLEG
LEEAGPSEAELEGAWRGPVAASLPMAIPAPRRGRGLGLEDATPSSSSENCVQETPLVLSR
CSSVSSLGSFESPSIASSIPSDPCSGLGSGTVSPSELPDSPGQTMPPSRSKTPPLAQAPP
GEREATQFSLQWESYVKRFLDIADCRERCRLPSELDAGSVRFTVEKPDENFSCASSLSAL
ALHELYVQKDVELRLLPPTCPERSSGGGGGPGHRRRDETGGRLEGPPSTDQELELLRECL
GGAVPARLRKVASALMPGRRALPVPVYMLVPAPAREDDSCTDSADGTPVNFSSAASLSDE
TLQGPSRNSGRVEGEKPAGRATPSRQPTGHRHRAGGVGRSLEQPRGAGRSRAGLDLPLRR
PPSTCGDKDGSRPGQVHGDGARQSLCLTTPTEEAVYCFYGNDSDEEPSTRVAAAPPRRAS
AIPRAVKRERLVGGRKEVQAVPKAAPKAAPPARAQPSLIADETPPCYSLSSSASSLSDPE
PSEHAANWSRAREPGVTKDPGPGGRRDGSPSPRAEAELLRRCIGSAMPRRQPQVSGPRRR
QPQPQPQAAQSEERPAEGPRELGEEAAGSDRASDLDSVEWRAIQEGANSIVTWLHQAAAA
ATREASSESDSVLSFASGLSVGSTLQHSLHRKGRRPRAEGQAGSTKRPEKGDTALAQRSS
GPEKPRGTQKTASGVPAVLRGRTVIYVPSPATRAQPRGAPGPRAVPRKMGAPSAVQPAAP
GPGQQRSRSLHRPGKISELAALSPPQRSATPPARLAKTPSSSSSQTSPASQPLPKRSPPA
AQATGPLPGPGASPVPKTPARALLAKQHKTQKSPVRIPFMQRPARRGPPPLARAAPEPGP
RGRAGSEGGPATRGGRLGLVRVASARSTGSESSDRSGFRRQLTFIKESPGLLRRRRSDLS
APEAPTPATQAGSPRRGRPALPAVFLCSSRCDELRAPRQAPASQRPPAARTGAGERPPRR
TSSESPSRLPVRTPAARPETVKRYASLPHISVARRPDAAAPRPVVDAARRSSDGEARPLP
RVAAPGTTWRRIRDEDVPHILRSTLPATALPLIGSSPEEGPAGPPQRKTSDAVVQTEDFA
ATKTNSSTSPSLESRAPPQATAGGPTSLLGSDVDGPGPTKAPATAPFIHEGLGVAAGVFP
ASRHGSPSRAARVPPFNYVPSPMVAATTDSAVEKAPAPAPTSLLE
NT seq 6798 nt   +upstreamnt  +downstreamnt
atgacaagctctatggcaccctacgagcagctggtgcggcaggtggaggccttgaaggcc
gagaacagtcacctgaggcaggagcttcgtgataactcaagccacctatccaagctggag
aatgagacgtcaggcatgaaggaggtcctgaagcacttacagggcaagctggagcaggag
gcccgagcgctggtgtcctcggggcagacggaagtgctggagcagctgaaggccctgcag
atggacatcaccagcctgtacaacctcaagttccagcccccggctctggcccctgagcct
gctgcccggacccctgacggaagtccggtacacagctccgggccctccaaggacaacttt
ggggagttgagccgggctaccatccggctgctggaggaactagaccgggaacggtgtttc
ctgttgaatgagattgagaaggaagagaaggagaagctctggtattactcgcagcttcag
ggcctgtccaagcgtctggacgagctcccacacgtggaaacgcagttctcgatgcagatg
gatctgattcggcagcagctagagttcgaggcccagcacattcgctcgctgatggaggag
cgcttcggcacctcggacgagatggtgcagcgggcacagatccgtgcctcccgcctggag
cagatcgacaaggaactactgtccgcgcaggaccgggtgcagcagaccgagccccaggcc
ttgctggcagtgaagtcagtgccaatggacgaggaccctgagactgaggtccccactcat
cctgaggatggtgcccctcaacctggcaatagcaaggtggaggtggtcttctggctgctg
tccatgttggcgacgcgtgaccaggaggacacggcacggacgctgctggctatgtccagc
tcacctgagagctgcgtggccatgcgccgctccggctgcctgccgctgctactgcagatc
ctgcatggcactgaggcgggggttgggggtcgtaacggagccccaggggctccaggagcc
aaggacgcgcgcatgcgcgccaacgcagcgctgcacaacatcgtcttctcccagccggac
cagggtctggcgcgcaaggagatgcgcgtcctgcatgtgcttgagcagatccgcgcctat
tgtgagacctgctgggactggctgcagacccgcaacagcgggccagagggagccggcgcc
ggcagcgccccgatccccattgagccgcagatctgccaggccacctgcgccgtgatgaag
ctgtccttcgacgaggaataccgccgcgccatgaacgagctaggtgggctgcaggctgtg
gcggagttactgcaggtcgactatgagatgcacaagatgacccgggaccctctcaacctg
gccctgcgccgatatgctggcatgaccctcaccaacctcacctttggggatgtcgccaac
aaggccacactgtgtgcccggcggggctgcatggaggccatcgtggcccagctggcatct
gagagcgaggagctgcaccaggtcgtttccagcatcttgcgcaacctgtcttggagggct
gacatcaacagcaagaaggtgctgagggaggtgggcagcatgaccgccctgatgcaatgc
gtccttcgagcctccaaggagtccaccctgaaaagcgtgctcagcgccctgtggaacctc
tcggctcacagcacagagaacaaggctgccatctgccaggtggacggcgccctgggcttc
ctggtgagcacactgacctacaagtgccagagcaactcactggccatcatcgagagcggc
ggtggcatcctgcgcaacgtgtccagcctcatcgccacgcgggaggactacaggcaggtg
ctgcgggaccacaactgcctgcagacactgctgcaacacctgacttcgcacagcctgacc
atcgtgagcaatgcctgtggcacactctggaacctgtctgcccgtagccctcgcgaccag
gagctactgtgggacctgggcgccgtgggcatgctgcgcaacctggtacactcaaagcac
aagatgatcgccatgggcagtgctgccgccctgcgcaacctgctggcccaccggcccgcc
aagtaccaggcagctgccactgccatctcccctggcgcctgtgtgcccagcctgtatgtg
cgcaagcagcgggctctggaagcagagctggatgcgaggcacctggcacaggcgctcgat
cacctggaaaagcagggccttcctgaggccgaggctgcctccaagaagccactgccaccc
ctgcggcacctggatggcctcgcccaggactacgcctctgactcgggctgcttcgacgat
gacgatgcaccctctctggctgctgccgcagccactgccacagccgagcctgccagccct
gccatgctgtccctcttcctgggcagccccttcctgcaggggcaggcactggcccgtgcc
cccactgcccgccgtggtggcctggagacagagaaggagaccgggggggaggcagccgtg
gcagccagggccaaggccaagttggcactggcagtggcgcgtatcgaccggctggtggag
gatatctctgccctgcacacctcgtctgatgacagcttcagcctcagctctggggatcct
gggcaggaggccccacgggagggccgtgcccaatcctgctcaccctgccgggggcctgac
ggtggacggcgggaggccagtagccgagctcacccactgctgcggctcaaggcagggcac
accagcctctccaatgacagccttaacagtggcagcaccagcgacgggcactgtccacgt
gagcactcgcggccctgtcctctggtcacactggctgagcaccgagaggggcctccgtgt
ggtcaggcacggcctagccggcttgaccttggcctggccaatggcaagcctgagccggca
gcccgggacaccacagctacagatgcccatgtgcgcaccatcaagctgtcacctacttac
cagcatgtgccactgcttgagggcacaaccagggtgggtgcagggtccctggcccctggg
gcccgtaaacaggcctggctgcccacagagggcctaagcaaagcgcctgagaagctggca
gtggagacggcacctctcagcctgtcccactgcagctccctgtcctcactgtcctcggcc
ggccgcccagggcccagtgaggctggggacctggacgacagtgattcatccctggagggg
ctagaggaggccggtcccagtgaggcagaactggagggggcctggcgggggccagtggct
gcctccctgcccatggccatcccggcaccccggcggggccggggcctggggctggaggac
gccacaccctccagctcatctgagaattgcgtgcaggagaccccactggtgctgagccgc
tgcagctcagtcagctcactgggcagctttgagagcccatccattgctagttctattccc
agcgacccatgcagcgggctgggcagcggcacagtaagccccagtgaactgcccgacagc
cctgggcaaacaatgccaccaagccgcagcaagacgccaccgctggcccaggcaccacca
ggcgagcgtgaggccacccagttcagcctgcagtgggagagctatgtgaagcgcttcctg
gacattgctgactgccgtgagcgctgccggctgccatcggagctggacgcaggcagtgtg
cgctttactgtagaaaagcccgatgagaacttctcctgtgcttccagcctcagtgcatta
gctctgcatgagctctacgtacagaaggacgtggagctgcggctgctgccccccacctgc
ccagagcgcagcagcggtggaggtggaggccctggacaccggcggcgggatgagactggt
ggtcgcctggaagggccaccatccacagaccaggagctggagcttcttcgcgagtgcttg
ggtggggccgtgcccgcccggctccgcaaggtggcctcagcactgatgcctggccgccgt
gcgctgcctgtgcccgtctacatgcttgtgcctgccccggcccgggaggacgactcttgc
actgactcggctgatggcacacctgtcaatttctccagtgccgcctcactcagcgatgag
acgctgcagggaccctctaggaacagcgggcgtgtggagggggagaagcctgcaggccgc
gccaccccctccaggcagcctactgggcaccggcacagggcaggaggtgtgggccgcagc
ttggagcagccccggggggctggcagaagccgggcagggctggacctacccctccgccgg
cccccgagcacctgtggggataaggatggctcccgcccaggccaggtgcatggggatggg
gcccggcagtctctgtgcctcacgacacccactgaggaggctgtgtactgcttctatggc
aatgattcggatgaggagccatccacaagggtggcagcagcgcccccgcggagggcatcg
gcaatccctagggcagtgaagagggagcgcctagttgggggcaggaaggaggtgcaagct
gtgcccaaggccgcgcccaaggccgcaccacctgcccgggctcagcctagcctcatcgca
gatgaaacaccaccatgctactccctgagctcctcagctagctccctcagtgatcctgag
ccctctgagcatgcagccaactggtcccgagcccgtgagccaggggtcaccaaagacccg
ggcccagggggcaggagggatggctcccccagtcctcgggcagaggcagagctgctgcgg
cgctgcattggctcagccatgcccaggcgccagccccaggtgtccggccccaggcgtcgc
cagccccagccccagccccaagctgcacagtcagaggagcggccggcagaggggccccgg
gagctgggagaagaggcggcgggctccgaccgagcctcagacctggacagtgttgagtgg
cgggccatccaggagggcgccaactccattgtcacctggttgcaccaggccgcagcagca
gccacccgagaggcctcgtctgagtcagattctgttctgtcctttgcatcggggctgtca
gtgggctccaccttacagcactctctgcacaggaaagggcgacggccaagggcagaaggc
caggcaggcagtaccaagcggccagagaaaggggacacggcccttgcccagcgcagcagc
ggcccagagaagccacgtggcactcagaagactgcatcaggggtgccagctgtgctccgg
ggacggacagtgatctacgtgcccagcccagccacccgggcccagcccagaggtgccccc
ggcccccgagctgtgccgagaaagatgggagccccaagcgctgtgcagccagcagcccct
ggccctggacagcagcggtctcggagcctgcaccggccaggcaagatctcggaactggca
gcactgagcccccctcaaaggagcgccacgccaccggcccgcctggccaaaaccccttca
tcgagctcctcacagacctcccccgcctcccagcctctgcccaagagatcacccccggct
gcccaggctacagggcccctgcctggccctggggcctctccagtgcccaagactcctgca
cgagccctgctggccaaacagcacaagacacagaagtcacccgtgcggatccccttcatg
cagaggcctgccaggcgggggccgccaccactggccagggcagccccggagccaggcccc
agaggccgggcagggtctgagggaggcccggccactagaggtggccgcctgggtctggtg
cgtgtggcctccgcgcgctccaccggcagcgagtcctcggaccgctctggtttccggcgg
cagctgaccttcatcaaggagtcgcccggcctgctgcgccgtcgacgctctgacctttct
gcaccggaggcccccacccccgccacccaggccggctcgccccgccgtggccggccagca
ctacccgccgtcttcctctgctcctcgcgctgtgacgagctgcgggccccccggcaggcc
ccggcttcccagcgtccccccgcagcccggacaggcgccggcgagcggccgccccgacgc
acaagctccgagagcccttcccgcctgccagtccgcacgccggcagcccggcccgagaca
gtcaagcgctatgcctccctgcctcacatcagcgtggcccgcaggcccgacgccgccgca
cccaggcccgtggtggacgccgctcgccgcagcagcgatggggaggcccggccgctgccc
agggtggccgcgccgggcaccacgtggcgtcgcatccgggacgaggacgtcccgcacatc
ttgcggagcactctgcccgccactgccctgccactgataggctcctcgcccgaggagggt
ccggccggcccaccacagcgcaagaccagcgacgccgtagtccagacagaagacttcgct
gccaccaagaccaactccagcacttcccccagcctggagagcagggccccccctcaggcc
acggccggtggccccacctctctactcggcagcgatgtcgacgggccaggccccaccaag
gcgcccgccaccgcccccttcatccacgagggcctgggggtggctgcaggggtcttcccc
gccagccggcacggctcccccagccgcgcagcccgcgttccccccttcaactatgtgccc
agccccatggtggccgctaccactgactcggccgtggagaaagcccccgcccccgccccc
acaagcctcctggaatag

DBGET integrated database retrieval system