KEGG   Sus scrofa (pig): 100518074
Entry
100518074         CDS       T01009                                 

Gene name
PRKCG
Definition
(RefSeq) protein kinase C gamma type isoform X3
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc04010  MAPK signaling pathway
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04015  Rap1 signaling pathway
ssc04020  Calcium signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04070  Phosphatidylinositol signaling system
ssc04071  Sphingolipid signaling pathway
ssc04150  mTOR signaling pathway
ssc04270  Vascular smooth muscle contraction
ssc04310  Wnt signaling pathway
ssc04370  VEGF signaling pathway
ssc04510  Focal adhesion
ssc04540  Gap junction
ssc04613  Neutrophil extracellular trap formation
ssc04650  Natural killer cell mediated cytotoxicity
ssc04666  Fc gamma R-mediated phagocytosis
ssc04670  Leukocyte transendothelial migration
ssc04713  Circadian entrainment
ssc04720  Long-term potentiation
ssc04723  Retrograde endocannabinoid signaling
ssc04724  Glutamatergic synapse
ssc04725  Cholinergic synapse
ssc04726  Serotonergic synapse
ssc04727  GABAergic synapse
ssc04728  Dopaminergic synapse
ssc04730  Long-term depression
ssc04750  Inflammatory mediator regulation of TRP channels
ssc04911  Insulin secretion
ssc04916  Melanogenesis
ssc04918  Thyroid hormone synthesis
ssc04919  Thyroid hormone signaling pathway
ssc04921  Oxytocin signaling pathway
ssc04925  Aldosterone synthesis and secretion
ssc04928  Parathyroid hormone synthesis, secretion and action
ssc04929  GnRH secretion
ssc04935  Growth hormone synthesis, secretion and action
ssc04960  Aldosterone-regulated sodium reabsorption
ssc04961  Endocrine and other factor-regulated calcium reabsorption
ssc04970  Salivary secretion
ssc04971  Gastric acid secretion
ssc04972  Pancreatic secretion
ssc05017  Spinocerebellar ataxia
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05031  Amphetamine addiction
ssc05032  Morphine addiction
ssc05143  African trypanosomiasis
ssc05146  Amoebiasis
ssc05161  Hepatitis B
ssc05163  Human cytomegalovirus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05171  Coronavirus disease - COVID-19
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05206  MicroRNAs in cancer
ssc05214  Glioma
ssc05223  Non-small cell lung cancer
ssc05225  Hepatocellular carcinoma
ssc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100518074 (PRKCG)
   04012 ErbB signaling pathway
    100518074 (PRKCG)
   04014 Ras signaling pathway
    100518074 (PRKCG)
   04015 Rap1 signaling pathway
    100518074 (PRKCG)
   04310 Wnt signaling pathway
    100518074 (PRKCG)
   04370 VEGF signaling pathway
    100518074 (PRKCG)
   04066 HIF-1 signaling pathway
    100518074 (PRKCG)
   04020 Calcium signaling pathway
    100518074 (PRKCG)
   04070 Phosphatidylinositol signaling system
    100518074 (PRKCG)
   04071 Sphingolipid signaling pathway
    100518074 (PRKCG)
   04150 mTOR signaling pathway
    100518074 (PRKCG)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100518074 (PRKCG)
   04540 Gap junction
    100518074 (PRKCG)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100518074 (PRKCG)
   04650 Natural killer cell mediated cytotoxicity
    100518074 (PRKCG)
   04666 Fc gamma R-mediated phagocytosis
    100518074 (PRKCG)
   04670 Leukocyte transendothelial migration
    100518074 (PRKCG)
  09152 Endocrine system
   04911 Insulin secretion
    100518074 (PRKCG)
   04929 GnRH secretion
    100518074 (PRKCG)
   04921 Oxytocin signaling pathway
    100518074 (PRKCG)
   04935 Growth hormone synthesis, secretion and action
    100518074 (PRKCG)
   04918 Thyroid hormone synthesis
    100518074 (PRKCG)
   04919 Thyroid hormone signaling pathway
    100518074 (PRKCG)
   04928 Parathyroid hormone synthesis, secretion and action
    100518074 (PRKCG)
   04916 Melanogenesis
    100518074 (PRKCG)
   04925 Aldosterone synthesis and secretion
    100518074 (PRKCG)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100518074 (PRKCG)
  09154 Digestive system
   04970 Salivary secretion
    100518074 (PRKCG)
   04971 Gastric acid secretion
    100518074 (PRKCG)
   04972 Pancreatic secretion
    100518074 (PRKCG)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100518074 (PRKCG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100518074 (PRKCG)
  09156 Nervous system
   04724 Glutamatergic synapse
    100518074 (PRKCG)
   04727 GABAergic synapse
    100518074 (PRKCG)
   04725 Cholinergic synapse
    100518074 (PRKCG)
   04728 Dopaminergic synapse
    100518074 (PRKCG)
   04726 Serotonergic synapse
    100518074 (PRKCG)
   04720 Long-term potentiation
    100518074 (PRKCG)
   04730 Long-term depression
    100518074 (PRKCG)
   04723 Retrograde endocannabinoid signaling
    100518074 (PRKCG)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100518074 (PRKCG)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100518074 (PRKCG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100518074 (PRKCG)
   05206 MicroRNAs in cancer
    100518074 (PRKCG)
   05205 Proteoglycans in cancer
    100518074 (PRKCG)
   05231 Choline metabolism in cancer
    100518074 (PRKCG)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100518074 (PRKCG)
   05214 Glioma
    100518074 (PRKCG)
   05223 Non-small cell lung cancer
    100518074 (PRKCG)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100518074 (PRKCG)
   05022 Pathways of neurodegeneration - multiple diseases
    100518074 (PRKCG)
  09165 Substance dependence
   05031 Amphetamine addiction
    100518074 (PRKCG)
   05032 Morphine addiction
    100518074 (PRKCG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100518074 (PRKCG)
   05161 Hepatitis B
    100518074 (PRKCG)
   05171 Coronavirus disease - COVID-19
    100518074 (PRKCG)
   05163 Human cytomegalovirus infection
    100518074 (PRKCG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100518074 (PRKCG)
   05143 African trypanosomiasis
    100518074 (PRKCG)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100518074 (PRKCG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100518074 (PRKCG)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100518074 (PRKCG)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100518074 (PRKCG)
SSDB
Motif
Pfam: Pkinase C1_1 PK_Tyr_Ser-Thr C2 Pkinase_C Kinase-like
Other DBs
NCBI-GeneID: 100518074
NCBI-ProteinID: XP_003356089
Ensembl: ENSSSCG00000003256
LinkDB
Position
6
AA seq 697 aa
MAGLGPGGGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTSDEIHITVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
KFEACNYPLELYERVRMGPSSSPIPSPSPSPTDSKRCFFGATPGRLHISDFSFLMVLGKG
SFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD
LKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPAKRLGS
GPDGEPTIRAHGFFRWIDWERLERLEIAPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQADFQGFTYVNPDFVHPDARSPISPAPVPVM
NT seq 2094 nt   +upstreamnt  +downstreamnt
atggcaggcctgggccccggcggaggcgattcagaggggggaccccggcccctgttttgc
agaaagggggctctgaggcagaaggtggtccacgaagtcaagagccacaagttcacagct
cgcttcttcaagcaaccaaccttctgcagccactgcactgacttcatatgggggattgga
aaacagggcctgcagtgtcaagtctgcagctttgtggttcaccgccgatgccacgaattt
gtgaccttcgagtgtccaggcgctgggaagggcccccagacggacgatcctcggaacaag
cacaagttccgtctgcacagctacagcagccccaccttctgcgaccactgcggctccctc
ctttacgggctggtgcatcagggcatgaaatgttcctgttgcgagatgaacgtgcaccgg
cgctgtgtgcgcagcgtgccctctctgtgcggtgtggaccacaccgagcgccgcgggcgc
ctgcagctggaaatccgggctcccacttcagatgagatccacatcacggttggtgaggcc
cgtaacctcatcccaatggaccccaatggtctgtctgacccctatgtgaaactgaaactc
atcccagaccctcggaatttgacaaaacagaagacccggaccgtgaaagccacgctaaac
cctgtgtggaacgagacctttgtgttcaacctgaagccaggggacgtggagcgccggctt
agcgtggaggtgtgggactgggaccggacctcccgcaacgacttcatgggtgccatgtcc
ttcggggtctcggagctgctcaaggcaccagtggacggctggtacaagttactgaaccag
gaggagggcgaatattacaatgtgccagtggctgatgctgacaactgcagcctcctccag
aagtttgaggcctgtaactaccccctggaactgtatgagagggtgcggatgggtccctca
tcctctcccatcccctccccatcccctagtcccaccgactccaagcgctgtttctttggg
gcgacccctggacgtctgcacatctcggacttcagcttcctcatggttctaggaaaaggc
agttttgggaaggtgatgctggcggagcgcaggggctcggatgagctctatgccatcaag
atcctgaagaaagacgtgattgtccaggatgacgacgtggactgcaccctggtggagaaa
cgtgtgctggccctggggggccgaggccccggaggccggcctcactttctcacccagctt
cactccaccttccagactccggatcgcctgtattttgtgatggagtacgtcaccgggggt
gacttgatgtaccacattcagcagctgggcaagttcaaggagccccatgcagcgttctac
gctgcagaaatcgccataggccttttcttccttcacaaccagggcatcatctaccgggac
ctgaaactggacaacgtgatgctggatgctgaaggacacatcaagatcactgactttggc
atgtgcaaggagaacgtcttccccgggaccaccactcgcaccttctgtgggaccccagac
tatatagcccccgagatcattgcctaccagccctatgggaagtctgtcgactggtggtcc
tttggggtcctgctgtatgagatgttggcaggccagcccccctttgatggggaggacgag
gaggagctgtttcaggccatcatggaacaaacggtcacctaccccaagtcgctgtcccgc
gaagctgtggccatctgcaaggggttcctaaccaagcacccagcaaagcgcctgggctca
gggccagatggagaacccaccatcagagctcatggcttcttccgctggatcgactgggaa
cggctggaacgactggagatcgcccctccgttcagaccccgtccatgtggccgcagcggt
gagaacttcgacaagttcttcacgcgggcggcgccagcgctgacgcccccagaccgccta
gtcctggccagcattgaccaagctgatttccaaggcttcacttatgtcaacccggatttt
gtgcacccggatgcccgcagccccatcagcccagcacctgtgcccgtcatgtaa

KEGG   Sus scrofa (pig): 100522792
Entry
100522792         CDS       T01009                                 

Gene name
PRKCB
Definition
(RefSeq) protein kinase C beta type isoform X1
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc04010  MAPK signaling pathway
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04015  Rap1 signaling pathway
ssc04020  Calcium signaling pathway
ssc04062  Chemokine signaling pathway
ssc04064  NF-kappa B signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04070  Phosphatidylinositol signaling system
ssc04071  Sphingolipid signaling pathway
ssc04150  mTOR signaling pathway
ssc04270  Vascular smooth muscle contraction
ssc04310  Wnt signaling pathway
ssc04370  VEGF signaling pathway
ssc04510  Focal adhesion
ssc04540  Gap junction
ssc04613  Neutrophil extracellular trap formation
ssc04650  Natural killer cell mediated cytotoxicity
ssc04662  B cell receptor signaling pathway
ssc04666  Fc gamma R-mediated phagocytosis
ssc04670  Leukocyte transendothelial migration
ssc04713  Circadian entrainment
ssc04720  Long-term potentiation
ssc04723  Retrograde endocannabinoid signaling
ssc04724  Glutamatergic synapse
ssc04725  Cholinergic synapse
ssc04726  Serotonergic synapse
ssc04727  GABAergic synapse
ssc04728  Dopaminergic synapse
ssc04730  Long-term depression
ssc04750  Inflammatory mediator regulation of TRP channels
ssc04911  Insulin secretion
ssc04912  GnRH signaling pathway
ssc04916  Melanogenesis
ssc04918  Thyroid hormone synthesis
ssc04919  Thyroid hormone signaling pathway
ssc04921  Oxytocin signaling pathway
ssc04925  Aldosterone synthesis and secretion
ssc04928  Parathyroid hormone synthesis, secretion and action
ssc04929  GnRH secretion
ssc04931  Insulin resistance
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc04935  Growth hormone synthesis, secretion and action
ssc04960  Aldosterone-regulated sodium reabsorption
ssc04961  Endocrine and other factor-regulated calcium reabsorption
ssc04970  Salivary secretion
ssc04971  Gastric acid secretion
ssc04972  Pancreatic secretion
ssc04973  Carbohydrate digestion and absorption
ssc05017  Spinocerebellar ataxia
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05031  Amphetamine addiction
ssc05032  Morphine addiction
ssc05140  Leishmaniasis
ssc05143  African trypanosomiasis
ssc05146  Amoebiasis
ssc05161  Hepatitis B
ssc05163  Human cytomegalovirus infection
ssc05164  Influenza A
ssc05170  Human immunodeficiency virus 1 infection
ssc05171  Coronavirus disease - COVID-19
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05206  MicroRNAs in cancer
ssc05214  Glioma
ssc05223  Non-small cell lung cancer
ssc05225  Hepatocellular carcinoma
ssc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100522792 (PRKCB)
   04012 ErbB signaling pathway
    100522792 (PRKCB)
   04014 Ras signaling pathway
    100522792 (PRKCB)
   04015 Rap1 signaling pathway
    100522792 (PRKCB)
   04310 Wnt signaling pathway
    100522792 (PRKCB)
   04370 VEGF signaling pathway
    100522792 (PRKCB)
   04064 NF-kappa B signaling pathway
    100522792 (PRKCB)
   04066 HIF-1 signaling pathway
    100522792 (PRKCB)
   04020 Calcium signaling pathway
    100522792 (PRKCB)
   04070 Phosphatidylinositol signaling system
    100522792 (PRKCB)
   04071 Sphingolipid signaling pathway
    100522792 (PRKCB)
   04150 mTOR signaling pathway
    100522792 (PRKCB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100522792 (PRKCB)
   04540 Gap junction
    100522792 (PRKCB)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100522792 (PRKCB)
   04650 Natural killer cell mediated cytotoxicity
    100522792 (PRKCB)
   04662 B cell receptor signaling pathway
    100522792 (PRKCB)
   04666 Fc gamma R-mediated phagocytosis
    100522792 (PRKCB)
   04670 Leukocyte transendothelial migration
    100522792 (PRKCB)
   04062 Chemokine signaling pathway
    100522792 (PRKCB)
  09152 Endocrine system
   04911 Insulin secretion
    100522792 (PRKCB)
   04929 GnRH secretion
    100522792 (PRKCB)
   04912 GnRH signaling pathway
    100522792 (PRKCB)
   04921 Oxytocin signaling pathway
    100522792 (PRKCB)
   04935 Growth hormone synthesis, secretion and action
    100522792 (PRKCB)
   04918 Thyroid hormone synthesis
    100522792 (PRKCB)
   04919 Thyroid hormone signaling pathway
    100522792 (PRKCB)
   04928 Parathyroid hormone synthesis, secretion and action
    100522792 (PRKCB)
   04916 Melanogenesis
    100522792 (PRKCB)
   04925 Aldosterone synthesis and secretion
    100522792 (PRKCB)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100522792 (PRKCB)
  09154 Digestive system
   04970 Salivary secretion
    100522792 (PRKCB)
   04971 Gastric acid secretion
    100522792 (PRKCB)
   04972 Pancreatic secretion
    100522792 (PRKCB)
   04973 Carbohydrate digestion and absorption
    100522792 (PRKCB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100522792 (PRKCB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100522792 (PRKCB)
  09156 Nervous system
   04724 Glutamatergic synapse
    100522792 (PRKCB)
   04727 GABAergic synapse
    100522792 (PRKCB)
   04725 Cholinergic synapse
    100522792 (PRKCB)
   04728 Dopaminergic synapse
    100522792 (PRKCB)
   04726 Serotonergic synapse
    100522792 (PRKCB)
   04720 Long-term potentiation
    100522792 (PRKCB)
   04730 Long-term depression
    100522792 (PRKCB)
   04723 Retrograde endocannabinoid signaling
    100522792 (PRKCB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100522792 (PRKCB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100522792 (PRKCB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100522792 (PRKCB)
   05206 MicroRNAs in cancer
    100522792 (PRKCB)
   05205 Proteoglycans in cancer
    100522792 (PRKCB)
   05231 Choline metabolism in cancer
    100522792 (PRKCB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100522792 (PRKCB)
   05214 Glioma
    100522792 (PRKCB)
   05223 Non-small cell lung cancer
    100522792 (PRKCB)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100522792 (PRKCB)
   05022 Pathways of neurodegeneration - multiple diseases
    100522792 (PRKCB)
  09165 Substance dependence
   05031 Amphetamine addiction
    100522792 (PRKCB)
   05032 Morphine addiction
    100522792 (PRKCB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100522792 (PRKCB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100522792 (PRKCB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100522792 (PRKCB)
   05161 Hepatitis B
    100522792 (PRKCB)
   05171 Coronavirus disease - COVID-19
    100522792 (PRKCB)
   05164 Influenza A
    100522792 (PRKCB)
   05163 Human cytomegalovirus infection
    100522792 (PRKCB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100522792 (PRKCB)
   05140 Leishmaniasis
    100522792 (PRKCB)
   05143 African trypanosomiasis
    100522792 (PRKCB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100522792 (PRKCB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100522792 (PRKCB)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100522792 (PRKCB)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100522792 (PRKCB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like CEP76-C2 APH
Other DBs
NCBI-GeneID: 100522792
NCBI-ProteinID: XP_020942118
LinkDB
Position
3
AA seq 673 aa
MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIEREVLIVVVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGGEGNEE
LRQKFERAKIGQGTKTPEEKTTNTISKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE
RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI
KIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP
FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF
RYIDWEKLERKEIQPPYKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFS
FVNSEFLKPEVKS
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggctgacccggctgcggggccgccgccgagtgagggcgaggagagcaccgtgcgcttc
gcccgcaaaggcgccctccggcagaagaacgtgcacgaggtgaagaaccacaaattcacc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggcttc
gggaagcaaggattccagtgccaagtctgctgttttgttgtgcacaagcggtgccatgaa
tttgtcaccttctcctgcccaggcgctgacaagggcccagcctctgatgacccccggagc
aaacacaagttcaagatccacacgtactccagccccacgttttgtgaccactgtgggtcc
ctgctgtatggactcatccaccaggggatgaagtgtgacacctgcatgatgaacgtccac
aagcgctgcgtgatgaacgtgcccagcctgtgtggcacagaccacacggagcgccgcggc
cgcatctacatccaggcccacatcgagagggaggttctcatcgtggtcgtaagagatgct
aaaaaccttgtacctatggaccccaatggcttgtcagacccttacgtgaaactgaaactg
attcctgatcccaagagcgagagcaagcagaagaccaaaaccatcaagtgctccctcaac
cccgagtggaacgagacatttagattccagctgaaagagtcagacaaagacagaagactg
tctgtagagatttgggattgggatttgaccagcaggaatgacttcatgggatctttgtct
tttgggatttccgaactgcagaaagccggtgttgatggctggtttaagttactgagccag
gaggaaggcgagtacttcaacgtacctgtgccaccagaaggaggggagggcaatgaggaa
ctgcggcagaaatttgagagggccaagatcggtcaggggaccaagactcccgaagagaag
acgaccaacaccatatccaagttcgataacaacgggaacagggaccggatgaaactgact
gattttaacttcttgatggtgttggggaaaggcagctttggcaaggtcatgctttccgag
cggaagggcacagatgagctgtacgcggtgaagatcctgaaaaaggatgtggtgattcaa
gacgatgatgtggaatgcacgatggtggagaagcgggtgctggccctgcccgggaagccg
cccttcctgacccagctgcattcctgcttccagaccatggaccgcctgtactttgtgatg
gagtatgtgaatggtggcgacctcatgtaccacattcagcaagtgggccgcttcaaagag
cctcacgctgtattttacgctgcagaaattgccatcggtctgttcttcttgcagagcaag
ggtatcatttaccgtgacctgaaacttgacaatgtgatgctggattccgagggccacatc
aagatcgctgattttggcatgtgtaaggaaaacatctgggatggggtgacgaccaagacc
ttctgtggcaccccagactacatcgcccctgagataattgcttatcagccctatgggaag
tccgtggattggtgggcatttggagtcctgctgtatgaaatgttggctgggcaggcaccc
tttgaaggcgaggatgaggatgaacttttccagtccatcatggaacacaacgtggcatat
ccaaagtccatgtccaaggaagccgtggccatctgcaaagggttgatgaccaaacacccg
ggcaaacgactgggttgcggacctgaaggtgaacgtgacatcaaagagcatgcgtttttc
cggtatatcgactgggagaaactcgaacgcaaagagattcagcccccatataagccgaaa
gcctgtgggcgaaatgctgaaaacttcgaccgatttttcacccgccatccaccagtccta
acacctcctgaccaggaagtcatcaggaatattgaccaatcagaattcgaaggattttcc
tttgttaactctgaatttttaaaacctgaagtcaagagctaa

KEGG   Sus scrofa (pig): 397184
Entry
397184            CDS       T01009                                 

Gene name
PRKCA
Definition
(RefSeq) LOW QUALITY PROTEIN: protein kinase C alpha type
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc04010  MAPK signaling pathway
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04015  Rap1 signaling pathway
ssc04020  Calcium signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04070  Phosphatidylinositol signaling system
ssc04071  Sphingolipid signaling pathway
ssc04072  Phospholipase D signaling pathway
ssc04150  mTOR signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04261  Adrenergic signaling in cardiomyocytes
ssc04270  Vascular smooth muscle contraction
ssc04310  Wnt signaling pathway
ssc04360  Axon guidance
ssc04370  VEGF signaling pathway
ssc04510  Focal adhesion
ssc04540  Gap junction
ssc04613  Neutrophil extracellular trap formation
ssc04650  Natural killer cell mediated cytotoxicity
ssc04664  Fc epsilon RI signaling pathway
ssc04666  Fc gamma R-mediated phagocytosis
ssc04670  Leukocyte transendothelial migration
ssc04713  Circadian entrainment
ssc04720  Long-term potentiation
ssc04723  Retrograde endocannabinoid signaling
ssc04724  Glutamatergic synapse
ssc04725  Cholinergic synapse
ssc04726  Serotonergic synapse
ssc04727  GABAergic synapse
ssc04728  Dopaminergic synapse
ssc04730  Long-term depression
ssc04750  Inflammatory mediator regulation of TRP channels
ssc04911  Insulin secretion
ssc04912  GnRH signaling pathway
ssc04916  Melanogenesis
ssc04918  Thyroid hormone synthesis
ssc04919  Thyroid hormone signaling pathway
ssc04921  Oxytocin signaling pathway
ssc04925  Aldosterone synthesis and secretion
ssc04926  Relaxin signaling pathway
ssc04928  Parathyroid hormone synthesis, secretion and action
ssc04929  GnRH secretion
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc04935  Growth hormone synthesis, secretion and action
ssc04960  Aldosterone-regulated sodium reabsorption
ssc04961  Endocrine and other factor-regulated calcium reabsorption
ssc04970  Salivary secretion
ssc04971  Gastric acid secretion
ssc04972  Pancreatic secretion
ssc05017  Spinocerebellar ataxia
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05031  Amphetamine addiction
ssc05032  Morphine addiction
ssc05143  African trypanosomiasis
ssc05146  Amoebiasis
ssc05161  Hepatitis B
ssc05163  Human cytomegalovirus infection
ssc05164  Influenza A
ssc05170  Human immunodeficiency virus 1 infection
ssc05171  Coronavirus disease - COVID-19
ssc05200  Pathways in cancer
ssc05205  Proteoglycans in cancer
ssc05206  MicroRNAs in cancer
ssc05214  Glioma
ssc05223  Non-small cell lung cancer
ssc05225  Hepatocellular carcinoma
ssc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    397184 (PRKCA)
   04012 ErbB signaling pathway
    397184 (PRKCA)
   04014 Ras signaling pathway
    397184 (PRKCA)
   04015 Rap1 signaling pathway
    397184 (PRKCA)
   04310 Wnt signaling pathway
    397184 (PRKCA)
   04370 VEGF signaling pathway
    397184 (PRKCA)
   04066 HIF-1 signaling pathway
    397184 (PRKCA)
   04020 Calcium signaling pathway
    397184 (PRKCA)
   04070 Phosphatidylinositol signaling system
    397184 (PRKCA)
   04072 Phospholipase D signaling pathway
    397184 (PRKCA)
   04071 Sphingolipid signaling pathway
    397184 (PRKCA)
   04151 PI3K-Akt signaling pathway
    397184 (PRKCA)
   04150 mTOR signaling pathway
    397184 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    397184 (PRKCA)
   04540 Gap junction
    397184 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    397184 (PRKCA)
   04650 Natural killer cell mediated cytotoxicity
    397184 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    397184 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    397184 (PRKCA)
   04670 Leukocyte transendothelial migration
    397184 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    397184 (PRKCA)
   04929 GnRH secretion
    397184 (PRKCA)
   04912 GnRH signaling pathway
    397184 (PRKCA)
   04921 Oxytocin signaling pathway
    397184 (PRKCA)
   04926 Relaxin signaling pathway
    397184 (PRKCA)
   04935 Growth hormone synthesis, secretion and action
    397184 (PRKCA)
   04918 Thyroid hormone synthesis
    397184 (PRKCA)
   04919 Thyroid hormone signaling pathway
    397184 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    397184 (PRKCA)
   04916 Melanogenesis
    397184 (PRKCA)
   04925 Aldosterone synthesis and secretion
    397184 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    397184 (PRKCA)
   04270 Vascular smooth muscle contraction
    397184 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    397184 (PRKCA)
   04971 Gastric acid secretion
    397184 (PRKCA)
   04972 Pancreatic secretion
    397184 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    397184 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    397184 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    397184 (PRKCA)
   04727 GABAergic synapse
    397184 (PRKCA)
   04725 Cholinergic synapse
    397184 (PRKCA)
   04728 Dopaminergic synapse
    397184 (PRKCA)
   04726 Serotonergic synapse
    397184 (PRKCA)
   04720 Long-term potentiation
    397184 (PRKCA)
   04730 Long-term depression
    397184 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    397184 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    397184 (PRKCA)
  09158 Development and regeneration
   04360 Axon guidance
    397184 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    397184 (PRKCA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    397184 (PRKCA)
   05206 MicroRNAs in cancer
    397184 (PRKCA)
   05205 Proteoglycans in cancer
    397184 (PRKCA)
   05231 Choline metabolism in cancer
    397184 (PRKCA)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    397184 (PRKCA)
   05214 Glioma
    397184 (PRKCA)
   05223 Non-small cell lung cancer
    397184 (PRKCA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    397184 (PRKCA)
   05022 Pathways of neurodegeneration - multiple diseases
    397184 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    397184 (PRKCA)
   05032 Morphine addiction
    397184 (PRKCA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    397184 (PRKCA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    397184 (PRKCA)
   05161 Hepatitis B
    397184 (PRKCA)
   05171 Coronavirus disease - COVID-19
    397184 (PRKCA)
   05164 Influenza A
    397184 (PRKCA)
   05163 Human cytomegalovirus infection
    397184 (PRKCA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    397184 (PRKCA)
   05143 African trypanosomiasis
    397184 (PRKCA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    397184 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    397184 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssc04131]
    397184 (PRKCA)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     397184 (PRKCA)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   397184 (PRKCA)
Membrane trafficking [BR:ssc04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    397184 (PRKCA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like APH
Other DBs
NCBI-GeneID: 397184
NCBI-ProteinID: XP_020922399
Ensembl: ENSSSCG00000017268
LinkDB
Position
12
AA seq 672 aa
MADVFPANDSTASQDVANRFARKGALRQKNVHEVKNHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTDEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNVE
LRQKFEKAKLGPAGNKVISPSEDRRQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGXSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPGKRLGCGPEGERDVREHAFFRRI
DWEKLENXEIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVN
PQFVHPILQSAV
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggctgacgttttcccggccaacgactccacggcgtctcaggacgtggccaatcgtttc
gcccgcaaaggggcgctgagacagaagaatgtgcacgaggtgaagaaccacaaattcatc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctgggggttt
gggaaacaaggcttccagtgccaagtttgctgttttgtggttcacaagaggtgccatgag
ttcgttactttttcttgtccgggtgcggataaaggacctgacactgatgacccccggagc
aagcacaagtttaagatccacacgtatggaagccccaccttctgcgaccactgcgggtcc
ttgctgtatggacttatccatcaagggatgaaatgtgacacctgtgacatgaacgtgcac
aagcagtgtgtgatcaacgtccccagcctctgcggcatggaccacacggagaagaggggg
cgcatctacctgaaagccgaggtcaccgacgagaagctccacgtcacagtacgagacgca
aaaaatctaatccctatggatccaaatgggctctcagatccttatgtgaagctgaaactt
attcctgatcccaagaacgaaagcaaacaaaaaaccaagaccatccgctctacactcaac
ccccagtggaacgagtccttcacgttcaaattaaaaccttcagataaagaccgacgactg
tctgtagaaatctgggactgggaccgaacaacaaggaacgacttcatgggctccctttcc
ttcggagtttcagagctgatgaagatgccggccagcggatggtacaagttgctcaaccag
gaagaaggtgagtactacaatgtgcccattccagaaggagacgaagaaggaaacgtggag
ctcaggcagaaattcgagaaagccaagctgggccctgccggtaacaaagtgatcagtcct
tctgaagacaggagacagccttccaacaaccttgaccgagtgaagctcaccgacttcaat
ttcctcatggtgctggggaagggcagtttcgggaaggtgatgctcgccgacaggaaggga
acggaagaactgtatgccatcaaaatcctgaagaaggacgtggtgattcaagacgacgac
gtggagtgcaccatggtggagaagcgcgtactggccctgttggataagcctccgttcctg
acgcagctacactcctgcttccagacagtggaccggctgtacttcgtcatggaatatgtc
aatggaggggacctcatgtaccacattcagcaagtaggaaaatttaaggaaccgcaagcc
gtattctatgcagcagaaatttccatcgggctgttcttccttcataaaagaggaatcatt
tatagggacctgaagttggataacgtcatgctggattcggagggccacatcaagattgcc
gattttgggatgtgtaaggagcacatgatggatggggtcacgaccaggaccttctgcggg
accccagattacatcgccccggagatcatcgcctatcagccgtatgggnaatccgtggac
tggtgggcctatggcgtcctgttatatgaaatgctggccggacagcctccgtttgatggc
gaagacgaggacgagctgtttcagtctatcatggagcacaacgtttcgtacccaaagtcc
ttgtccaaggaggccgtttccatctgcaaaggactgatgaccaagcaccccggcaagcgg
ctgggctgcggcccggagggagagcgggacgtccgggaacacgccttcttccggaggatc
gactgggagaagctggagaacngggagatccagccgcccttcaagcccaaagtgtgcggc
aaaggagccgaaaacttcgacaaattcttcacgcgggggcagcctgtcctcacgccgccc
gaccagctggtcatcgctaacatagaccagtctgatttcgaagggttctcgtatgtcaac
ccccagttcgtgcaccccatcttacagagcgcagtatga

DBGET integrated database retrieval system