KEGG   Sus scrofa (pig): 100518131
Entry
100518131         CDS       T01009                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00562  Inositol phosphate metabolism
ssc01100  Metabolic pathways
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc01522  Endocrine resistance
ssc01524  Platinum drug resistance
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04015  Rap1 signaling pathway
ssc04024  cAMP signaling pathway
ssc04062  Chemokine signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04068  FoxO signaling pathway
ssc04070  Phosphatidylinositol signaling system
ssc04071  Sphingolipid signaling pathway
ssc04072  Phospholipase D signaling pathway
ssc04140  Autophagy - animal
ssc04150  mTOR signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04152  AMPK signaling pathway
ssc04210  Apoptosis
ssc04211  Longevity regulating pathway
ssc04213  Longevity regulating pathway - multiple species
ssc04218  Cellular senescence
ssc04360  Axon guidance
ssc04370  VEGF signaling pathway
ssc04380  Osteoclast differentiation
ssc04510  Focal adhesion
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04611  Platelet activation
ssc04613  Neutrophil extracellular trap formation
ssc04620  Toll-like receptor signaling pathway
ssc04625  C-type lectin receptor signaling pathway
ssc04630  JAK-STAT signaling pathway
ssc04650  Natural killer cell mediated cytotoxicity
ssc04660  T cell receptor signaling pathway
ssc04662  B cell receptor signaling pathway
ssc04664  Fc epsilon RI signaling pathway
ssc04666  Fc gamma R-mediated phagocytosis
ssc04668  TNF signaling pathway
ssc04670  Leukocyte transendothelial migration
ssc04722  Neurotrophin signaling pathway
ssc04725  Cholinergic synapse
ssc04750  Inflammatory mediator regulation of TRP channels
ssc04810  Regulation of actin cytoskeleton
ssc04910  Insulin signaling pathway
ssc04914  Progesterone-mediated oocyte maturation
ssc04915  Estrogen signaling pathway
ssc04917  Prolactin signaling pathway
ssc04919  Thyroid hormone signaling pathway
ssc04923  Regulation of lipolysis in adipocytes
ssc04926  Relaxin signaling pathway
ssc04929  GnRH secretion
ssc04930  Type II diabetes mellitus
ssc04931  Insulin resistance
ssc04932  Non-alcoholic fatty liver disease
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc04935  Growth hormone synthesis, secretion and action
ssc04960  Aldosterone-regulated sodium reabsorption
ssc04973  Carbohydrate digestion and absorption
ssc05010  Alzheimer disease
ssc05017  Spinocerebellar ataxia
ssc05020  Prion disease
ssc05100  Bacterial invasion of epithelial cells
ssc05132  Salmonella infection
ssc05135  Yersinia infection
ssc05142  Chagas disease
ssc05146  Amoebiasis
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05162  Measles
ssc05163  Human cytomegalovirus infection
ssc05164  Influenza A
ssc05165  Human papillomavirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05168  Herpes simplex virus 1 infection
ssc05169  Epstein-Barr virus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05171  Coronavirus disease - COVID-19
ssc05200  Pathways in cancer
ssc05203  Viral carcinogenesis
ssc05205  Proteoglycans in cancer
ssc05206  MicroRNAs in cancer
ssc05210  Colorectal cancer
ssc05211  Renal cell carcinoma
ssc05212  Pancreatic cancer
ssc05213  Endometrial cancer
ssc05214  Glioma
ssc05215  Prostate cancer
ssc05218  Melanoma
ssc05220  Chronic myeloid leukemia
ssc05221  Acute myeloid leukemia
ssc05222  Small cell lung cancer
ssc05223  Non-small cell lung cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
ssc05230  Central carbon metabolism in cancer
ssc05231  Choline metabolism in cancer
ssc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ssc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100518131 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100518131 (PIK3CD)
   04014 Ras signaling pathway
    100518131 (PIK3CD)
   04015 Rap1 signaling pathway
    100518131 (PIK3CD)
   04370 VEGF signaling pathway
    100518131 (PIK3CD)
   04630 JAK-STAT signaling pathway
    100518131 (PIK3CD)
   04668 TNF signaling pathway
    100518131 (PIK3CD)
   04066 HIF-1 signaling pathway
    100518131 (PIK3CD)
   04068 FoxO signaling pathway
    100518131 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    100518131 (PIK3CD)
   04072 Phospholipase D signaling pathway
    100518131 (PIK3CD)
   04071 Sphingolipid signaling pathway
    100518131 (PIK3CD)
   04024 cAMP signaling pathway
    100518131 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    100518131 (PIK3CD)
   04152 AMPK signaling pathway
    100518131 (PIK3CD)
   04150 mTOR signaling pathway
    100518131 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100518131 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    100518131 (PIK3CD)
   04218 Cellular senescence
    100518131 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100518131 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    100518131 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100518131 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100518131 (PIK3CD)
   04613 Neutrophil extracellular trap formation
    100518131 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    100518131 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    100518131 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    100518131 (PIK3CD)
   04660 T cell receptor signaling pathway
    100518131 (PIK3CD)
   04662 B cell receptor signaling pathway
    100518131 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    100518131 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    100518131 (PIK3CD)
   04670 Leukocyte transendothelial migration
    100518131 (PIK3CD)
   04062 Chemokine signaling pathway
    100518131 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100518131 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    100518131 (PIK3CD)
   04929 GnRH secretion
    100518131 (PIK3CD)
   04915 Estrogen signaling pathway
    100518131 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    100518131 (PIK3CD)
   04917 Prolactin signaling pathway
    100518131 (PIK3CD)
   04926 Relaxin signaling pathway
    100518131 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    100518131 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    100518131 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100518131 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100518131 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    100518131 (PIK3CD)
   04722 Neurotrophin signaling pathway
    100518131 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100518131 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    100518131 (PIK3CD)
   04380 Osteoclast differentiation
    100518131 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    100518131 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    100518131 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100518131 (PIK3CD)
   05206 MicroRNAs in cancer
    100518131 (PIK3CD)
   05205 Proteoglycans in cancer
    100518131 (PIK3CD)
   05203 Viral carcinogenesis
    100518131 (PIK3CD)
   05230 Central carbon metabolism in cancer
    100518131 (PIK3CD)
   05231 Choline metabolism in cancer
    100518131 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100518131 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100518131 (PIK3CD)
   05212 Pancreatic cancer
    100518131 (PIK3CD)
   05225 Hepatocellular carcinoma
    100518131 (PIK3CD)
   05226 Gastric cancer
    100518131 (PIK3CD)
   05214 Glioma
    100518131 (PIK3CD)
   05221 Acute myeloid leukemia
    100518131 (PIK3CD)
   05220 Chronic myeloid leukemia
    100518131 (PIK3CD)
   05218 Melanoma
    100518131 (PIK3CD)
   05211 Renal cell carcinoma
    100518131 (PIK3CD)
   05215 Prostate cancer
    100518131 (PIK3CD)
   05213 Endometrial cancer
    100518131 (PIK3CD)
   05224 Breast cancer
    100518131 (PIK3CD)
   05222 Small cell lung cancer
    100518131 (PIK3CD)
   05223 Non-small cell lung cancer
    100518131 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100518131 (PIK3CD)
   05017 Spinocerebellar ataxia
    100518131 (PIK3CD)
   05020 Prion disease
    100518131 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100518131 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100518131 (PIK3CD)
   04932 Non-alcoholic fatty liver disease
    100518131 (PIK3CD)
   04931 Insulin resistance
    100518131 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100518131 (PIK3CD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100518131 (PIK3CD)
   05135 Yersinia infection
    100518131 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    100518131 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100518131 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    100518131 (PIK3CD)
   05161 Hepatitis B
    100518131 (PIK3CD)
   05160 Hepatitis C
    100518131 (PIK3CD)
   05171 Coronavirus disease - COVID-19
    100518131 (PIK3CD)
   05164 Influenza A
    100518131 (PIK3CD)
   05162 Measles
    100518131 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    100518131 (PIK3CD)
   05163 Human cytomegalovirus infection
    100518131 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100518131 (PIK3CD)
   05169 Epstein-Barr virus infection
    100518131 (PIK3CD)
   05165 Human papillomavirus infection
    100518131 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100518131 (PIK3CD)
   05142 Chagas disease
    100518131 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100518131 (PIK3CD)
   01524 Platinum drug resistance
    100518131 (PIK3CD)
   01522 Endocrine resistance
    100518131 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssc04131]
    100518131 (PIK3CD)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100518131 (PIK3CD)
Membrane trafficking [BR:ssc04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100518131 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 100518131
NCBI-ProteinID: XP_003127588
Ensembl: ENSSSCG00000003395
Vega: OTTSUSG00000002668
UniProt: A0A5K1UPW2
LinkDB
Position
6
AA seq 1044 aa
MPPGVDCPMEFWTKEENQSVDVDFLLPTGVYLNFPVSRNANLSTIKKVLWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSLHDPEVNDFRAKMRQFCEEAAARRQQLGWEAWLQYSFPLQLEPSARSWGP
GTLRVPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYT
LQVNGKHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPR
TKPPPIPMKKPSSVSLWSLEQPFCIELIQGSKVNADERMKLVVQAGLFHGNETLCKTVSS
SEVSVCSDPVWKQRLEFDINVCDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPAGTVRSNPNTESAAALVIFLPEVAP
HPVYYPSLDKILELGRHGEHGRFTEEEQLQLREILERRGSGELYEHEKDLVWKMRHEVQE
HFPEALARLLLVTKWNRHEDVAQMLYLLCSWPELPVLSALELLDFSFPDRHVGSFAIKSL
RKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSV
ALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDVVKVSSQKTTKPQTKELMHLCMR
QETYLEALSHLQSPLDPSILLAEVCVEQCTFMDSKMKPLWVMYSNEEAGSDGSVGIIFKN
GDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLSTGDRTGLIEVVLHSDTIANIQLN
KSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIM
IRENGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYC
ERAYAILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFN
EALRESWKTKVNWLAHNVSKDNRQ
NT seq 3135 nt   +upstreamnt  +downstreamnt
atgcccccaggggttgactgccccatggaattctggaccaaggaggagaatcagagcgta
gacgtggactttttgctgcccacgggggtctacctgaacttccctgtgtcccgaaatgcc
aacctcagcaccatcaagaaggtgttgtggcaccgagcccagtatgagccgctcttccac
atgctcagcgaccccgaggcctacgtgttcacctgcgtcaaccagactgcggagcagcag
gagctggaggacgagcagcggcggctgtgcgacatccagcccttcctgccggtcctgcgc
ctggtggcccgcgagggtgacagggtgaagaagctcatcaactcgcaaatcagcctgctc
ataggcaaagggctccacgagttcgactccttgcacgacccggaggtgaatgactttcga
gccaaaatgcgccagttctgcgaggaggcggccgcccgccggcagcagctgggctgggag
gcctggctgcagtacagcttcccgctgcagctggagccctccgcgcggagctgggggccc
ggcaccctgcgcgtccccaaccgtgccctcctggtcaacgtcaagttcgagggcagtgag
gagagcttcaccttccaggtatctaccaaggatgtgcccctggccctgatggcctgtgcc
ctgcggaagaaggccacggtgttccggcagccgctggtggagcagcccgaagactacacg
ctgcaggtgaacggcaagcatgagtacctgtatggcagctacccgctctgccagttccag
tacatctgcagctgcctgcacagcgggctgacgccccacctgaccatggtgcactcctcc
tccatcctcgccatgcgggacgaacagagcaaccccgccccccaagtccaaaagccccgc
accaaaccgccccccattcccatgaagaagccctcctccgtgtccctgtggtccctggag
cagcccttctgcatcgagctgatccagggcagcaaagtgaatgccgacgagcggatgaag
ctggtggtgcaggccgggctgtttcatggcaacgagacgctgtgcaagacggtgtccagc
tcggaggtgagcgtgtgctcggacccagtttggaagcagcggctggagttcgacatcaat
gtctgcgacctgccgcgcatggcccgcctctgcttcgccctctatgccgtgattgagaag
gccaagaaggctcgttccaccaagaagaagtccaagaaggcggactgccccatcgcctgg
gccaacctcatgctgtttgactacaaggaccagctcaagacaggcgagcgctgcctctat
atgtggccctcggtcccagatgagaaaggcgagctactgaaccccgcggggaccgtgcgg
agtaaccccaacactgagagcgcggctgccctggtcatctttctgcccgaggtggccccg
caccctgtgtactacccttccctggacaagatcctggagctggggcggcatggagagcac
gggcgcttcacggaggaggagcaactgcagctgcgggagatcctggagcggcgggggtcc
ggggagctgtacgagcacgagaaggacctggtgtggaagatgcggcacgaggtccaggag
cacttccccgaggcactggcccggctgctgctggtcaccaagtggaacaggcacgaggac
gtggcccagatgctctatctgctgtgctcctggcccgagctgcccgtcctgagtgccctg
gagctgctggacttcagcttccctgaccgccacgtgggctccttcgccatcaagtccctg
cggaaactgacggacgatgagcttttccaatacctgctgcagctggtgcaggtgctcaag
tacgagtcctacctcgactgcgagctgaccaaattcctgctggaccgggccctggccaat
cgcaagatcggccacttcctcttctggcacctccgctccgagatgcacgtgccgtcggtg
gccctgcgcttcggcctcatcatggaggcctactgcaggggcagcacccaccacatgaag
gtgctgatgaagcagggggaagcgctgagcaagctgaaggccctgaacgacgtcgtcaag
gtgagctcccagaagaccacgaagccccagaccaaggagctgatgcacctgtgcatgcgc
caggagacctacctggaggccctctcccacctgcagtccccgcttgaccccagcatcctg
ctggctgaagtctgcgtggagcagtgcacgttcatggactccaagatgaagccgctgtgg
gtcatgtacagcaacgaggaggcaggcagtgacggcagcgtgggcatcatctttaagaac
ggggacgacctccggcaggacatgctgaccttgcagatgatccagctcatggatgttctg
tggaagcaggaggggctggacctgaggatgactccctacggctgcctctccaccggggac
cgcacaggcctcatcgaggtggtgctccactcggacaccattgccaacatccagctgaac
aagagcaacatggcggccacggcggccttcaacaaggatgctctgctcaactggctcaag
tccaagaaccccggggaggccctggatcgagccatcgaggagttcaccctgtcctgcgct
ggctactgcgtggccacgtacgtgctgggcatcggggatcggcacagcgacaacatcatg
atccgcgagaacgggcagctgttccacattgatttcggccacttcctgggaaatttcaaa
accaagtttggaatcaaccgtgagcgagtcccgttcatccttacctatgactttgtccac
gtgatccagcaggggaagacgaataatagtgagaaatttgaaaggttccggggctactgt
gaacgagcctatgccatcctgcggcgccacgggctgctcttcctccacctcttcgccctg
atgcgggcagcaggcctgcctgagctcagctgctccaaagacatccagtacctcaaggac
tctctggccttggggaaaacggaggaggaggcgctaaagcacttccgggtgaagtttaac
gaagccctccgggagagctggaaaaccaaagtgaactggctggcccacaacgtgtccaaa
gataacaggcagtag

KEGG   Sus scrofa (pig): 100621789
Entry
100621789         CDS       T01009                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00562  Inositol phosphate metabolism
ssc01100  Metabolic pathways
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc01522  Endocrine resistance
ssc01524  Platinum drug resistance
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04015  Rap1 signaling pathway
ssc04024  cAMP signaling pathway
ssc04062  Chemokine signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04068  FoxO signaling pathway
ssc04070  Phosphatidylinositol signaling system
ssc04071  Sphingolipid signaling pathway
ssc04072  Phospholipase D signaling pathway
ssc04140  Autophagy - animal
ssc04150  mTOR signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04152  AMPK signaling pathway
ssc04210  Apoptosis
ssc04211  Longevity regulating pathway
ssc04213  Longevity regulating pathway - multiple species
ssc04218  Cellular senescence
ssc04360  Axon guidance
ssc04370  VEGF signaling pathway
ssc04380  Osteoclast differentiation
ssc04510  Focal adhesion
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04611  Platelet activation
ssc04613  Neutrophil extracellular trap formation
ssc04620  Toll-like receptor signaling pathway
ssc04625  C-type lectin receptor signaling pathway
ssc04630  JAK-STAT signaling pathway
ssc04650  Natural killer cell mediated cytotoxicity
ssc04660  T cell receptor signaling pathway
ssc04662  B cell receptor signaling pathway
ssc04664  Fc epsilon RI signaling pathway
ssc04666  Fc gamma R-mediated phagocytosis
ssc04668  TNF signaling pathway
ssc04670  Leukocyte transendothelial migration
ssc04722  Neurotrophin signaling pathway
ssc04725  Cholinergic synapse
ssc04750  Inflammatory mediator regulation of TRP channels
ssc04810  Regulation of actin cytoskeleton
ssc04910  Insulin signaling pathway
ssc04914  Progesterone-mediated oocyte maturation
ssc04915  Estrogen signaling pathway
ssc04917  Prolactin signaling pathway
ssc04919  Thyroid hormone signaling pathway
ssc04923  Regulation of lipolysis in adipocytes
ssc04926  Relaxin signaling pathway
ssc04929  GnRH secretion
ssc04930  Type II diabetes mellitus
ssc04931  Insulin resistance
ssc04932  Non-alcoholic fatty liver disease
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc04935  Growth hormone synthesis, secretion and action
ssc04960  Aldosterone-regulated sodium reabsorption
ssc04973  Carbohydrate digestion and absorption
ssc05010  Alzheimer disease
ssc05017  Spinocerebellar ataxia
ssc05020  Prion disease
ssc05100  Bacterial invasion of epithelial cells
ssc05132  Salmonella infection
ssc05135  Yersinia infection
ssc05142  Chagas disease
ssc05146  Amoebiasis
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05162  Measles
ssc05163  Human cytomegalovirus infection
ssc05164  Influenza A
ssc05165  Human papillomavirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05168  Herpes simplex virus 1 infection
ssc05169  Epstein-Barr virus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05171  Coronavirus disease - COVID-19
ssc05200  Pathways in cancer
ssc05203  Viral carcinogenesis
ssc05205  Proteoglycans in cancer
ssc05206  MicroRNAs in cancer
ssc05210  Colorectal cancer
ssc05211  Renal cell carcinoma
ssc05212  Pancreatic cancer
ssc05213  Endometrial cancer
ssc05214  Glioma
ssc05215  Prostate cancer
ssc05218  Melanoma
ssc05220  Chronic myeloid leukemia
ssc05221  Acute myeloid leukemia
ssc05222  Small cell lung cancer
ssc05223  Non-small cell lung cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
ssc05230  Central carbon metabolism in cancer
ssc05231  Choline metabolism in cancer
ssc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ssc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100621789 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100621789 (PIK3CA)
   04014 Ras signaling pathway
    100621789 (PIK3CA)
   04015 Rap1 signaling pathway
    100621789 (PIK3CA)
   04370 VEGF signaling pathway
    100621789 (PIK3CA)
   04630 JAK-STAT signaling pathway
    100621789 (PIK3CA)
   04668 TNF signaling pathway
    100621789 (PIK3CA)
   04066 HIF-1 signaling pathway
    100621789 (PIK3CA)
   04068 FoxO signaling pathway
    100621789 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    100621789 (PIK3CA)
   04072 Phospholipase D signaling pathway
    100621789 (PIK3CA)
   04071 Sphingolipid signaling pathway
    100621789 (PIK3CA)
   04024 cAMP signaling pathway
    100621789 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    100621789 (PIK3CA)
   04152 AMPK signaling pathway
    100621789 (PIK3CA)
   04150 mTOR signaling pathway
    100621789 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100621789 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    100621789 (PIK3CA)
   04218 Cellular senescence
    100621789 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100621789 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    100621789 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100621789 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100621789 (PIK3CA)
   04613 Neutrophil extracellular trap formation
    100621789 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    100621789 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    100621789 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    100621789 (PIK3CA)
   04660 T cell receptor signaling pathway
    100621789 (PIK3CA)
   04662 B cell receptor signaling pathway
    100621789 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    100621789 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    100621789 (PIK3CA)
   04670 Leukocyte transendothelial migration
    100621789 (PIK3CA)
   04062 Chemokine signaling pathway
    100621789 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100621789 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    100621789 (PIK3CA)
   04929 GnRH secretion
    100621789 (PIK3CA)
   04915 Estrogen signaling pathway
    100621789 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    100621789 (PIK3CA)
   04917 Prolactin signaling pathway
    100621789 (PIK3CA)
   04926 Relaxin signaling pathway
    100621789 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    100621789 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    100621789 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100621789 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100621789 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    100621789 (PIK3CA)
   04722 Neurotrophin signaling pathway
    100621789 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100621789 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    100621789 (PIK3CA)
   04380 Osteoclast differentiation
    100621789 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    100621789 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    100621789 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100621789 (PIK3CA)
   05206 MicroRNAs in cancer
    100621789 (PIK3CA)
   05205 Proteoglycans in cancer
    100621789 (PIK3CA)
   05203 Viral carcinogenesis
    100621789 (PIK3CA)
   05230 Central carbon metabolism in cancer
    100621789 (PIK3CA)
   05231 Choline metabolism in cancer
    100621789 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100621789 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100621789 (PIK3CA)
   05212 Pancreatic cancer
    100621789 (PIK3CA)
   05225 Hepatocellular carcinoma
    100621789 (PIK3CA)
   05226 Gastric cancer
    100621789 (PIK3CA)
   05214 Glioma
    100621789 (PIK3CA)
   05221 Acute myeloid leukemia
    100621789 (PIK3CA)
   05220 Chronic myeloid leukemia
    100621789 (PIK3CA)
   05218 Melanoma
    100621789 (PIK3CA)
   05211 Renal cell carcinoma
    100621789 (PIK3CA)
   05215 Prostate cancer
    100621789 (PIK3CA)
   05213 Endometrial cancer
    100621789 (PIK3CA)
   05224 Breast cancer
    100621789 (PIK3CA)
   05222 Small cell lung cancer
    100621789 (PIK3CA)
   05223 Non-small cell lung cancer
    100621789 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100621789 (PIK3CA)
   05017 Spinocerebellar ataxia
    100621789 (PIK3CA)
   05020 Prion disease
    100621789 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100621789 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100621789 (PIK3CA)
   04932 Non-alcoholic fatty liver disease
    100621789 (PIK3CA)
   04931 Insulin resistance
    100621789 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100621789 (PIK3CA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100621789 (PIK3CA)
   05135 Yersinia infection
    100621789 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    100621789 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100621789 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    100621789 (PIK3CA)
   05161 Hepatitis B
    100621789 (PIK3CA)
   05160 Hepatitis C
    100621789 (PIK3CA)
   05171 Coronavirus disease - COVID-19
    100621789 (PIK3CA)
   05164 Influenza A
    100621789 (PIK3CA)
   05162 Measles
    100621789 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    100621789 (PIK3CA)
   05163 Human cytomegalovirus infection
    100621789 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100621789 (PIK3CA)
   05169 Epstein-Barr virus infection
    100621789 (PIK3CA)
   05165 Human papillomavirus infection
    100621789 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100621789 (PIK3CA)
   05142 Chagas disease
    100621789 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100621789 (PIK3CA)
   01524 Platinum drug resistance
    100621789 (PIK3CA)
   01522 Endocrine resistance
    100621789 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssc04131]
    100621789 (PIK3CA)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100621789 (PIK3CA)
Membrane trafficking [BR:ssc04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100621789 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC Ribosomal_S15
Other DBs
NCBI-GeneID: 100621789
NCBI-ProteinID: XP_020925517
Ensembl: ENSSSCG00000030413
LinkDB
Position
13
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLVTIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccaagaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ctagtggaatgtttactaccaaatggaatgatagtgactttagaatgcctccgtgaggct
acattagtaactataaagcatgaactatttaaagaagcaagaaaataccctctccatcaa
cttcttcaagatgaatcttcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgatcttcggctttttcaaccatttttaaaa
gtaattgaaccagtaggcaaccgtgaagaaaagatcctcaatcgagaaattggttttgct
atcggcatgccagtgtgcgaatttgatatggttaaagatcctgaagtacaggacttccga
agaaatattcttaatgtttgtaaagaagctgtggatcttagggatcttaattcacctcat
agtagagcaatgtatgtctatcctccaaatgtagaatcttcaccagaactgccaaagcac
atatataataaattggataaagggcaaataatagtggtgatttgggtaatagtttctcca
aataatgacaagcagaagtatactctgaaaatcaaccatgactgtgtgccagaacaagta
attgctgaagcaatcaggaaaaaaactagaagtatgttgctatcatctgaacaattaaaa
ctctgtgttttagaatatcagggcaagtacattttaaaagtgtgtggatgtgatgaatac
ttcctagaaaaatatcctctgagtcagtataagtatataagaagctgtataatgcttggg
aggatgcccaatttgatgctgatggctaaagaaagcctttactctcaactgccaatggac
tgtttcacaatgccatcttattccagacgcatctccacagctactccatatatgaatgga
gaaacatctacaaaatccctttgggttataaacagcgcactcagaataaaaatactttgt
gcaacctatgtgaatgtaaatattcgagacattgacaagatctatgttcgaacaggtatc
taccatggaggagaaccattatgtgataatgtgaacactcaacgagtaccttgttccaat
cccaggtggaatgaatggctgaattacgatatatacattcctgatcttcctcgtgctgct
cgactttgcctttccatttgttctgttaaaggccgaaagggtgctaaagaggaacactgt
ccattggcctggggaaatataaacttgtttgattacacagatactctagtatctggaaaa
atggctttgaatctttggcctgtacctcatgggttagaagatttgctgaaccctattggt
gttactggatcaaatccaaataaagaaactccatgcttagagttggagtttgactggttc
agcagtgtggtgaagtttccagatatgtcagtgattgaagagcatgccaattggtctgta
tcccgagaagcaggatttagttactctcatgcaggactgagtaacagactagctagagac
aacgaattacgggaaaatgataaagaacagctccgagcaatttgtacacgagatcctcta
tctgaaatcactgagcaagagaaagattttctctggagccacagacactattgtgtaact
atccctgaaattctacccaagttgcttctgtctgttaaatggaattctagagatgaagta
gctcagatgtactgcttggtaaaagattggcctccaatcaaacctgaacaggctatggag
cttttggactgcaattacccagatcctatggttcgaggttttgctgttcgatgcttggaa
aaatatttaacagatgacaaactttctcagtacctaattcagctagtacaggtcctaaaa
tatgaacagtatttggataacctgcttgtgagatttttactcaaaaaagcattgactaat
caaagaattgggcactttttcttttggcatttaaaatctgagatgcacaataaaactgtt
agtcagaggtttggcctacttttggagtcctattgccgtgcatgtgggatgtatttgaag
cacttgaataggcaagttgaggctatggaaaagctcattaacttaactgacattctcaaa
caagagaagaaggatgaaacacaaaaggtacagatgaagtttttagttgaacaaatgagg
cgaccagatttcatggatgctctgcagggctttctatctcctctaaaccctgctcatcag
ctgggaaatctcaggcttgaagagtgtcgaattatgtcctctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagaattactctttcaaaacaatgagatcatc
tttaaaaatggggatgatttacggcaagatatgctaacacttcagattattcgcattatg
gaaaatatctggcaaaatcaaggtcttgatcttcgaatgttaccttatggttgtctgtca
attggtgactgtgtgggacttattgaggtggtgagaaattctcacactattatgcaaatt
cagtgcaaaggaggcctgaaaggtgcactgcagttcaacagccacacactacatcagtgg
ctcaaagacaagaacaagggcgaaatatatgatgcagccattgatctgtttacacgttca
tgtgctggatattgtgttgccaccttcattttgggaattggagatcgtcacaatagtaac
atcatggttaaagatgatggacaactgtttcatatagattttggacactttttggatcac
aagaagaaaaaatttggttataaacgagagcgtgtgccatttgttttgacacaagatttc
ttaatagtgattagtaaaggagcccaagaatgcacaaagacaagagaatttgagaggttt
caggagatgtgttacaaggcttatttagctattcggcagcatgccaatctcttcataaat
cttttctcaatgatgcttggctctggaatgccagaactacaatcttttgatgatattgca
tacattcgaaagaccctagctttagataaaactgagcaagaggctttggaatatttcatg
aaacaaatgaatgatgcacatcatggtggctggacaacaaaaatggattggatcttccac
acaattaagcagcatgctttgaactga

KEGG   Sus scrofa (pig): 100622559
Entry
100622559         CDS       T01009                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc00562  Inositol phosphate metabolism
ssc01100  Metabolic pathways
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc01522  Endocrine resistance
ssc01524  Platinum drug resistance
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04015  Rap1 signaling pathway
ssc04024  cAMP signaling pathway
ssc04062  Chemokine signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04068  FoxO signaling pathway
ssc04070  Phosphatidylinositol signaling system
ssc04071  Sphingolipid signaling pathway
ssc04072  Phospholipase D signaling pathway
ssc04140  Autophagy - animal
ssc04150  mTOR signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04152  AMPK signaling pathway
ssc04210  Apoptosis
ssc04211  Longevity regulating pathway
ssc04213  Longevity regulating pathway - multiple species
ssc04218  Cellular senescence
ssc04360  Axon guidance
ssc04370  VEGF signaling pathway
ssc04380  Osteoclast differentiation
ssc04510  Focal adhesion
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04611  Platelet activation
ssc04613  Neutrophil extracellular trap formation
ssc04620  Toll-like receptor signaling pathway
ssc04625  C-type lectin receptor signaling pathway
ssc04630  JAK-STAT signaling pathway
ssc04650  Natural killer cell mediated cytotoxicity
ssc04660  T cell receptor signaling pathway
ssc04662  B cell receptor signaling pathway
ssc04664  Fc epsilon RI signaling pathway
ssc04666  Fc gamma R-mediated phagocytosis
ssc04668  TNF signaling pathway
ssc04670  Leukocyte transendothelial migration
ssc04722  Neurotrophin signaling pathway
ssc04725  Cholinergic synapse
ssc04750  Inflammatory mediator regulation of TRP channels
ssc04810  Regulation of actin cytoskeleton
ssc04910  Insulin signaling pathway
ssc04914  Progesterone-mediated oocyte maturation
ssc04915  Estrogen signaling pathway
ssc04917  Prolactin signaling pathway
ssc04919  Thyroid hormone signaling pathway
ssc04923  Regulation of lipolysis in adipocytes
ssc04926  Relaxin signaling pathway
ssc04929  GnRH secretion
ssc04930  Type II diabetes mellitus
ssc04931  Insulin resistance
ssc04932  Non-alcoholic fatty liver disease
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc04935  Growth hormone synthesis, secretion and action
ssc04960  Aldosterone-regulated sodium reabsorption
ssc04973  Carbohydrate digestion and absorption
ssc05010  Alzheimer disease
ssc05017  Spinocerebellar ataxia
ssc05020  Prion disease
ssc05100  Bacterial invasion of epithelial cells
ssc05132  Salmonella infection
ssc05135  Yersinia infection
ssc05142  Chagas disease
ssc05146  Amoebiasis
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05162  Measles
ssc05163  Human cytomegalovirus infection
ssc05164  Influenza A
ssc05165  Human papillomavirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05168  Herpes simplex virus 1 infection
ssc05169  Epstein-Barr virus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05171  Coronavirus disease - COVID-19
ssc05200  Pathways in cancer
ssc05203  Viral carcinogenesis
ssc05205  Proteoglycans in cancer
ssc05206  MicroRNAs in cancer
ssc05210  Colorectal cancer
ssc05211  Renal cell carcinoma
ssc05212  Pancreatic cancer
ssc05213  Endometrial cancer
ssc05214  Glioma
ssc05215  Prostate cancer
ssc05218  Melanoma
ssc05220  Chronic myeloid leukemia
ssc05221  Acute myeloid leukemia
ssc05222  Small cell lung cancer
ssc05223  Non-small cell lung cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
ssc05230  Central carbon metabolism in cancer
ssc05231  Choline metabolism in cancer
ssc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ssc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100622559 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100622559 (PIK3CB)
   04014 Ras signaling pathway
    100622559 (PIK3CB)
   04015 Rap1 signaling pathway
    100622559 (PIK3CB)
   04370 VEGF signaling pathway
    100622559 (PIK3CB)
   04630 JAK-STAT signaling pathway
    100622559 (PIK3CB)
   04668 TNF signaling pathway
    100622559 (PIK3CB)
   04066 HIF-1 signaling pathway
    100622559 (PIK3CB)
   04068 FoxO signaling pathway
    100622559 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    100622559 (PIK3CB)
   04072 Phospholipase D signaling pathway
    100622559 (PIK3CB)
   04071 Sphingolipid signaling pathway
    100622559 (PIK3CB)
   04024 cAMP signaling pathway
    100622559 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    100622559 (PIK3CB)
   04152 AMPK signaling pathway
    100622559 (PIK3CB)
   04150 mTOR signaling pathway
    100622559 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100622559 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    100622559 (PIK3CB)
   04218 Cellular senescence
    100622559 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100622559 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    100622559 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100622559 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100622559 (PIK3CB)
   04613 Neutrophil extracellular trap formation
    100622559 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    100622559 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    100622559 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    100622559 (PIK3CB)
   04660 T cell receptor signaling pathway
    100622559 (PIK3CB)
   04662 B cell receptor signaling pathway
    100622559 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    100622559 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    100622559 (PIK3CB)
   04670 Leukocyte transendothelial migration
    100622559 (PIK3CB)
   04062 Chemokine signaling pathway
    100622559 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100622559 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    100622559 (PIK3CB)
   04929 GnRH secretion
    100622559 (PIK3CB)
   04915 Estrogen signaling pathway
    100622559 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    100622559 (PIK3CB)
   04917 Prolactin signaling pathway
    100622559 (PIK3CB)
   04926 Relaxin signaling pathway
    100622559 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    100622559 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    100622559 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100622559 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100622559 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    100622559 (PIK3CB)
   04722 Neurotrophin signaling pathway
    100622559 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100622559 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    100622559 (PIK3CB)
   04380 Osteoclast differentiation
    100622559 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    100622559 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    100622559 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100622559 (PIK3CB)
   05206 MicroRNAs in cancer
    100622559 (PIK3CB)
   05205 Proteoglycans in cancer
    100622559 (PIK3CB)
   05203 Viral carcinogenesis
    100622559 (PIK3CB)
   05230 Central carbon metabolism in cancer
    100622559 (PIK3CB)
   05231 Choline metabolism in cancer
    100622559 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100622559 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100622559 (PIK3CB)
   05212 Pancreatic cancer
    100622559 (PIK3CB)
   05225 Hepatocellular carcinoma
    100622559 (PIK3CB)
   05226 Gastric cancer
    100622559 (PIK3CB)
   05214 Glioma
    100622559 (PIK3CB)
   05221 Acute myeloid leukemia
    100622559 (PIK3CB)
   05220 Chronic myeloid leukemia
    100622559 (PIK3CB)
   05218 Melanoma
    100622559 (PIK3CB)
   05211 Renal cell carcinoma
    100622559 (PIK3CB)
   05215 Prostate cancer
    100622559 (PIK3CB)
   05213 Endometrial cancer
    100622559 (PIK3CB)
   05224 Breast cancer
    100622559 (PIK3CB)
   05222 Small cell lung cancer
    100622559 (PIK3CB)
   05223 Non-small cell lung cancer
    100622559 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100622559 (PIK3CB)
   05017 Spinocerebellar ataxia
    100622559 (PIK3CB)
   05020 Prion disease
    100622559 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100622559 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100622559 (PIK3CB)
   04932 Non-alcoholic fatty liver disease
    100622559 (PIK3CB)
   04931 Insulin resistance
    100622559 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100622559 (PIK3CB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100622559 (PIK3CB)
   05135 Yersinia infection
    100622559 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    100622559 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100622559 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    100622559 (PIK3CB)
   05161 Hepatitis B
    100622559 (PIK3CB)
   05160 Hepatitis C
    100622559 (PIK3CB)
   05171 Coronavirus disease - COVID-19
    100622559 (PIK3CB)
   05164 Influenza A
    100622559 (PIK3CB)
   05162 Measles
    100622559 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    100622559 (PIK3CB)
   05163 Human cytomegalovirus infection
    100622559 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100622559 (PIK3CB)
   05169 Epstein-Barr virus infection
    100622559 (PIK3CB)
   05165 Human papillomavirus infection
    100622559 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100622559 (PIK3CB)
   05142 Chagas disease
    100622559 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100622559 (PIK3CB)
   01524 Platinum drug resistance
    100622559 (PIK3CB)
   01522 Endocrine resistance
    100622559 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssc04131]
    100622559 (PIK3CB)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100622559 (PIK3CB)
Membrane trafficking [BR:ssc04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100622559 (PIK3CB)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C DUF4381
Other DBs
NCBI-GeneID: 100622559
NCBI-ProteinID: XP_020925183
Ensembl: ENSSSCG00000021203 ENSSSCG00000027164
LinkDB
Position
13
AA seq 1070 aa
MCFRFIMPPAMADILDIWAVDSQIASDGSIPVDFLLPTGIYIQLEVPREATISYIKQMLW
KQVHNYPMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGRGLHEFDALKDPEVNEFRIKMRKFSEEKIQSLVGLSWMDWLKQTYPPEH
EPSILENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPVKINELAIQKRLTIHGKEDE
VSPYDYVLQVSGRVEYVFGDYPLIQFQYIRNCVMNRTLPHFILVECCKIKKLYEQEMIAI
EAAINRNSSNLPLPLPPKKTRVISHIWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHG
TELLCKTIVSSEISGKNDHIWNEPLEFDINTCDLPRMARLCFAVYAVLDKVKTKKSTKTI
NPSKYQTIRKSGKVHYPVAWVNTMVFDFKGQLRSGDIILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHIKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLAVLKE
ILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALANRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKALSKQVEALNKLK
TLNSLIKLNAMKLNRAKGKEAMHTCLKQSAYREALSDLQSPLNPCVILSELYVEKCKYMD
SKMKPLWLVYNNKVFGEDSIGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgtgcttccgcttcataatgcctcctgctatggcagacatccttgacatctgggcagtg
gattcacagatagcatctgatggctccatacctgtggatttccttttacccactgggatt
tatatccagttggaggtacctcgggaagctaccatttcctatattaagcagatgttatgg
aagcaagttcacaattacccaatgtttaacctccttatggaaattgactcctatatgttt
gcatgtgtgaatcaaactgctgtatatgaggagctcgaagatgaaacaagaagactctgt
gatgtcaggccttttcttcctgttcttaaattagtaacaaggagttgtgacccaggggaa
aaattagactcaaaaattggagttcttataggaagaggtctgcatgaatttgatgccttg
aaggatcctgaagtgaatgaattccgaataaaaatgcgcaaattcagtgaggaaaagatt
cagtcacttgtgggattgtcttggatggattggctaaagcaaacctatccaccagagcat
gaaccatctatccttgaaaatttagaagataaactttatggaggaaagctcattgtggct
gttcattttgaaaattgtcaggatgtatttagctttcaagtatctcctaatatgaatcct
gtcaaaataaatgaattggcaatccaaaaacgtttgactattcatggcaaagaagatgaa
gttagcccctatgactatgtgttgcaagtcagtgggagagtagaatatgtgtttggtgat
taccccctaattcagttccagtatatccggaactgtgtaatgaacaggaccttgccccat
tttatacttgtggaatgttgcaagattaagaagctatatgaacaagaaatgattgccata
gaggctgccataaatcgaaattcatctaaccttcctctgcctttaccaccaaagaaaact
cgagttatctctcatatttgggaaaataacaaccctttccaaattgtcttggttaaggga
aataaacttaacacagaagaaactgtaaaagttcatgtcagggctggcctttttcatggt
accgaactcctgtgtaaaaccatcgtaagctcagagatatcagggaaaaatgatcatatt
tggaatgaacccctggaatttgatatcaatacttgcgacctgccacgaatggctcgatta
tgttttgctgtttatgcagtgttagataaagtgaaaacgaagaaatcaaccaaaactatt
aatccctctaaatatcagaccatcaggaaatctggaaaagtgcattatcctgtggcatgg
gtgaatacgatggtttttgactttaaaggacagttgcgatctggagatataatattacac
agctggtcttcatttcctgatgaacttgaagaaatgttgaatccaatgggaactgttcaa
acaaatccatatactgaaaatgcaacagctttgcatatcaaattcccagagaataaaaaa
caaccttattactaccctccttttgataagattattgaaaaggcagctgagattgcaagc
agtgatagtgctaatgtatcaagtcgaggtgggaagaagtttcttgctgtactgaaagaa
atcttggacagggatccattgtctcaactgtgtgagaatgaaatggatcttatttggact
ttgcgacaagactgcagagagaatttcccacagtcattgccaaaattactgctgtctatc
aagtggaataaacttgaggatgttgctcagcttcaggcactacttcagatttggcctaaa
ctgcccccgcgggaggccctggagcttctggatttcaactatccagatcagtacgtgcga
gaatatgctgttggctgcctgcgacagatgagtgatgaagaactctctcaatatctttta
caattggtgcaagttttaaaatatgagccttttcttgactgtgccctctctagattccta
ctagaaagagcacttgctaatcggaggataggacagtttctattttggcatcttaggtca
gaagtgcacattcctgctgtctcagtacagtttggtgtcatccttgaagcatactgccgg
ggaagtgtaggtcacatgaaggcactttccaagcaggttgaagcactcaataaattaaaa
actttaaatagtttaatcaaactgaatgcaatgaagctgaatagagccaaagggaaagag
gccatgcatacttgtttaaaacagagtgcttaccgggaagccctctctgacctgcagtca
cctctgaatccatgtgtcatcctctcagaactttatgttgaaaagtgtaaatatatggat
tccaaaatgaagcctttatggcttgtgtacaacaacaaggtgtttggtgaggattcaatt
ggagtgatttttaaaaatggtgatgacttacggcaggatatgttgacactccaaatgctg
cgcttgatggatttactctggaaagaagctggtctggatcttaggatgctgccttatggc
tgtttagcaacaggagaccgctctggcctcattgaagttgtgagcacctctgaaacaatt
gctgacattcagctgaacagtagcaatgtggctgcagcagcagccttcaacaaagatgcc
cttctgaactggcttaaagaatacaattctggggatgacctggaccgagccattgaggag
tttaccctgtcctgtgccggctactgtgtagcttcttatgtccttgggattggtgacaga
catagtgataacatcatggtcaaaaaaactggccagctcttccacattgactttggacat
attcttggaaatttcaagtctaaatttggcattaaaagggagcgagtgccttttattctt
acctatgatttcattcatgtgatccaacaaggaaaaacaggaaacacggaaaagtttggc
cggttccgccaatgttgtgaggatgcatatctgattttacgacggcatgggaatctcttc
atcactctctttgcactgatgttgactgcagggcttcctgagctcacatcagtcaaggat
atacaatatcttaaggactctcttgcattagggaagagtgaagaagaagcactcaagcaa
tttaagcaaaaatttgatgaggcactcagggaaagctggactactaaagtgaactggatg
gcccatacagtgcgaaaagactacagatcttag

DBGET integrated database retrieval system