KEGG   Sus scrofa (pig): 100518226
Entry
100518226         CDS       T01009                                 

Gene name
SLX4IP
Definition
(RefSeq) LOW QUALITY PROTEIN: protein SLX4IP
Organism
ssc  Sus scrofa (pig)
SSDB
Motif
Pfam: UPF0492
Other DBs
NCBI-GeneID: 100518226
NCBI-ProteinID: XP_020933711
LinkDB
Position
17
AA seq 417 aa
MASKKFAVKCGNFAVLVDLHILPQGSNKDTSWFSEQKKEEVCLLLRETIDSRVKEYLEVR
KQHRPSNAEFTRSSPLSLKGYGFQITAYFLKRGIRLWCLRGSQHSELRVFPDRFVVCVSQ
LAFSRDLLASQQEELMGRAVQGVTEDFTECAERPLPPGAECKRRALQEIVNRTETQSVVS
KSCGYEDIVGTSGDSVIAEGAKKRXNTQTSSHPLDPTGQAKSTEEAAENHQGLPVPQLEK
AAETPPDPLRQQPAQTSPRARLETGLLXREPVCSCESASMAPKQSPRGARXAEDSDHRRR
VSLASDPLVPREIRVGGWGVGSKAVRALSASELSDPGLLLKQDLAESNSNAELHVLENLS
SRQLMKNKPGQAEQTRSATNPERXAPIQGSPTKKRKQHEKDRWRGLQTCWRRLQIDC
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggcatcaaagaaatttgctgttaaatgtgggaattttgctgtcctggtggatcttcac
atattaccgcaaggttcaaacaaagataccagctggttttctgaacagaagaaagaggaa
gtctgtttactgttaagagaaaccattgattcgagagtgaaggagtacttagaagttcgt
aaacagcacaggccgtcaaatgcagaattcacgagatccagtcccttgtccttaaaaggt
tatggctttcaaatcacagcctattttctcaagagagggattcgcctctggtgcctcagg
ggctcacagcattcagaactccgtgtatttcccgacagatttgtggtctgtgtaagtcag
cttgccttcagtcgtgaccttttggcaagtcagcaggaagagttgatgggaagagccgtc
caaggagtgacagaggatttcaccgagtgtgcagagaggccacttcctcccggtgcagag
tgcaagaggagggccctgcaagaaattgtgaaccgaactgaaacacaaagcgtcgtgagc
aaatcctgcggctatgaggacatcgtgggaacatctggtgactccgtgattgcagagggc
gcaaagaagaggnggaacactcagacctcgtcccatcccctggatcccacgggacaagct
aagtccacagaggaggcagccgagaaccaccaggggcttcccgttccacagctggaaaaa
gctgctgagaccccaccagatcctctccgccagcagccagcgcagacctcaccccgggcg
cggctggagacagggcttctancgcgggagccggtctgtagctgtgagtcagcatccatg
gctccaaaacagagtccacgaggggctcggncggctgaggactccgaccaccgcaggaga
gtttctcttgcaagtgatccattagtcccaagagaaataagagtgggggggtggggggtg
ggaagcaaagccgtcagggccctgtcagcttcagagctgtcagatccagggttactcttg
aaacaagacttggcagaaagcaactctaatgcagagttgcatgttttggaaaatctctcc
tccagacagcttatgaaaaataagccagggcaggcagagcaaacccgctcagccacaaac
cctgaaagatgagctccgattcaaggcagcccaaccaagaaaagaaagcagcatgagaaa
gaccgctggagaggattgcagacttgctggagaagactgcagattgattgctga

DBGET integrated database retrieval system