KEGG   Sus scrofa (pig): 100518649
Entry
100518649         CDS       T01009                                 

Gene name
JAK3
Definition
(RefSeq) tyrosine-protein kinase JAK3 isoform X1
  KO
K11218  Janus kinase 3 [EC:2.7.10.2]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04062  Chemokine signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04217  Necroptosis
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04630  JAK-STAT signaling pathway
ssc04658  Th1 and Th2 cell differentiation
ssc04659  Th17 cell differentiation
ssc05161  Hepatitis B
ssc05162  Measles
ssc05166  Human T-cell leukemia virus 1 infection
ssc05169  Epstein-Barr virus infection
ssc05200  Pathways in cancer
ssc05203  Viral carcinogenesis
ssc05223  Non-small cell lung cancer
ssc05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100518649 (JAK3)
   04151 PI3K-Akt signaling pathway
    100518649 (JAK3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100518649 (JAK3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100518649 (JAK3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100518649 (JAK3)
   04659 Th17 cell differentiation
    100518649 (JAK3)
   04062 Chemokine signaling pathway
    100518649 (JAK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100518649 (JAK3)
   05203 Viral carcinogenesis
    100518649 (JAK3)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    100518649 (JAK3)
  09163 Immune disease
   05340 Primary immunodeficiency
    100518649 (JAK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100518649 (JAK3)
   05161 Hepatitis B
    100518649 (JAK3)
   05162 Measles
    100518649 (JAK3)
   05169 Epstein-Barr virus infection
    100518649 (JAK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    100518649 (JAK3)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100518649 (JAK3)
Protein kinases [BR:ssc01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   100518649 (JAK3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl Kdo APH
Other DBs
NCBI-GeneID: 100518649
NCBI-ProteinID: XP_003123548
Ensembl: ENSSSCG00000013888
Vega: OTTSUSG00000003526
UniProt: K7GSE8
LinkDB
Position
2
AA seq 1103 aa
MAPPSEETPLIPQRSCSLSSSEAGALHVLLPPRGPGPPQRLSFSFGDHSAEELCVWAAKA
SGILPVYHSLFALATEDLSCWFPPSHIFSVEDAGTQVLVYRLRFYFPNWFGLEKCHRFGL
RKDLTSAILDLPVLEHLFAQHRNDLVSGRLPVGLGLKEQGECLSLAVLDLARMALEKAQR
PEELLKIVSYKVCLPPALRDLIQGLSFVTRRRIRRTVRRALRRVAACQADRHSLMAKYIM
DLERLDPARAAETFRVGLPAAAGGQDAPGLLRVAGGSGISWSPGEEVLQPFCDFPEIVDI
SIKQAPRVGPAGEHRLVTVTRTDNQILEAEFPGLPAALSFVALVDGYFRLTTDSQHFFCK
EVAPPRLLEEVAEQCHGPITLDFAINKLKTGGSLPGSYVLRRSPQDFDSYLLTVCVQTPL
GPDYKGCLIRCDPTGTFSLVGLSRPHNSLRALLAACWDGGLHVDGVELNLTFCCTPRPKE
KSNLIVIRRGCSLPTSSPVQPQSQCQLSQMTFHKIPADSLEWHENLGHGSFTKIYRGCRH
EAVDGEARETEVLLKVMDAKHKNCMESFLEAASLMSQVSYQHLVLLHGVCMAGDSIMVQE
FVHLGALDTYLRKCGHLVPASWKLQVIKQLAYALNYLEDKGLPHGNVSARKVLLAREGAD
GNPPFIKLSDPGVSPTVLSLEMLTDRIPWVAPECLQEARTLGLEADKWGFGATVWEVFSG
VMMPISTLDPAKKLQFYQERQQLPAPKWMELALLIQQCMAYEPGQRPSFRAVIRDLNSLI
TSDYELLSDPTPGALAPRDGLWNGAQLYACQDPTIFEERHLKYISQLGKGNFGSVELCRY
DPLGDNTGALVAVKQLQHSGPEQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRLV
MEYLPSGCLRDFLQRHRARLDAGRLLLYASQICKGMEYLGSRRCVHRDLAARNILVESET
HVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELF
TYSDKSCSPSAEFLRMMGCERDVPALCRLLELLAEGQRLPAPPACPSEVHELMKLCWAPS
PQDRPSFSTLGPQLDALWSGGRG
NT seq 3312 nt   +upstreamnt  +downstreamnt
atggcacctccaagtgaagagacacccttgatccctcagcgctcctgcagcctctcctct
tcagaggctggtgccctgcatgttctgctgccccctcggggccctggacccccacagcgc
ctatccttctcctttggggaccactccgctgaagagctgtgtgtttgggctgctaaggcc
agtggtatcctgcctgtgtaccactccctctttgctctggccacggaggacctgtcctgt
tggttccccccaagccacatcttctccgtggaggatgcaggcacccaagtcctcgtctac
aggctccgcttttacttccccaactggtttgggctagagaaatgccaccgctttgggcta
cgaaaggacttaaccagtgccattcttgacctgccagtcctggagcatctctttgctcag
catcgcaacgacttggtgagtggccgcctcccagtgggcctcggcctcaaggagcagggt
gagtgtctcagcttggccgtcctggacctggcccggatggccctcgagaaggctcagcgg
cctgaagagctgctgaagattgtcagctacaaggtctgcctgccccctgctctacgtgac
ctgatccaaggcctgagtttcgtgacgcggaggcgtattcgaaggacagtgcgtcgggcc
ctgcgtcgcgtggccgcctgccaggctgaccgacactcgctcatggccaagtacattatg
gacctcgagcgtctggacccagccagggcagccgagaccttccgcgtgggccttcccgcg
gctgctggtggtcaggatgcgccagggctgctccgtgtggctggtggcagcggcatctcc
tggagcccaggagaagaggttcttcagcccttctgcgactttccagaaatcgtggatatc
agcatcaagcaggccccgcgcgttggccccgccggggagcatcgcctggtcacagtcacc
aggacagacaaccagatcctggaggctgagttccccgggctgcctgccgcgctgtccttc
gtggcgctggtggatggctacttccggctgaccaccgactcgcagcacttcttctgcaag
gaggtggcgccgccgcggcttctggaagaggtggctgagcagtgccatggccccatcacc
ctggattttgccatcaacaaactcaagactgggggctcacttcctggctcctacgttctc
cgtcgcagccctcaggatttcgacagttacctcctaactgtctgtgtccagacccctctg
ggccctgattacaagggctgcctcatccggtgtgaccctacgggaaccttctccctggtt
ggccttagccgtccccacaacagtcttcgagcgctcctggcagcctgttgggatggtggg
ttgcacgtggatggggttgagctgaatctcactttctgctgcacccccagacccaaagaa
aagtccaatctgatagtgatccggaggggttgcagtctgcccacctcatcccctgttcag
ccccagtcccaatgccagctgagccagatgacatttcacaagatccctgccgacagccta
gagtggcatgagaacttgggtcatggatccttcaccaagatttaccggggctgtcgccac
gaggctgtggatggggaggcccgggagacagaagtcctgctcaaagtgatggatgccaag
cacaagaactgcatggagtcattcctggaagcagcgagcttgatgagccaagtatcatac
cagcatctcgtgttgctccatggcgtatgcatggctggagacagcatcatggtgcaggaa
ttcgtacacctgggagcattggacacgtatctgcgcaagtgtggccacctggtgccagca
agctggaagctacaggtgatcaaacagctggcctatgccctcaactatctggaagacaaa
ggtctcccccatggcaacgtctcagcccggaaggtgctcctggctcgagagggggccgat
gggaacccgccttttatcaagctgagtgatcctggtgtcagccccactgtactaagcctg
gagatgcttaccgacaggatcccctgggtggcccctgagtgtctccaggaggcccgaaca
cttggcttggaagctgacaagtggggctttggtgccacagtctgggaggtgttcagcggt
gtcatgatgcccatcagcactctggatcctgccaagaagctacagttttaccaggaacgg
caacagctccctgcccccaagtggatggagctggccctgctgatccagcagtgcatggcc
tacgagccaggccagaggccttccttccgtgctgtcatccgtgacctgaacagcctcatc
acttcagattatgaactcctctcagaccccacgcctggtgccctagcaccccgtgacggg
ctttggaatggcgcccagctctatgcctgccaggaccctaccatctttgaggagagacac
ctcaagtacatctcacagctgggcaagggcaactttggcagcgtggaactctgccgctac
gacccactgggcgacaacacaggtgctctggtggccgtgaagcagctgcagcacagtggc
ccagaacagcagagggacttccagcgggagatccagatccttaaagccctccacagcgac
ttcattgtcaagtaccggggtgtcagctatggcccaggccgccagagtctgcggctggtc
atggaatatctgccaagcggctgcctgcgggacttcctgcagaggcaccgcgcgcgccta
gatgctggccgcctgctcctctacgcctcgcaaatctgcaagggcatggagtacctgggc
tcccgccgctgcgtgcaccgcgacctggcagcccgtaacatcctggtggagagcgaaacg
cacgtcaagatcgccgacttcggcctcgcgaagctgctgccgctagacaaagactactat
gtggtccgcgagcccggccagagccccatcttctggtatgccccggagtccctctcagac
aatatcttctcgcgccagtcggatgtctggagcttcggggtcgtgctgtatgagctcttc
acctacagcgacaagagctgtagcccctcagccgagttcctgcggatgatgggatgtgag
cgagatgtcccagccctctgtcgtctcctggagctgctggccgaaggccagaggctgccc
gcacctcctgcctgtcctagtgaggttcatgagctcatgaagctgtgctgggcccctagc
cctcaagatcggccatcattcagcaccctgggccctcagctggatgcactgtggagtgga
ggccggggatag

DBGET integrated database retrieval system