KEGG   Sus scrofa (pig): 100518650
Entry
100518650         CDS       T01009                                 

Gene name
POLK
Definition
(RefSeq) LOW QUALITY PROTEIN: DNA polymerase kappa
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc03460  Fanconi anemia pathway
ssc05169  Epstein-Barr virus infection
ssc05200  Pathways in cancer
ssc05202  Transcriptional misregulation in cancer
ssc05210  Colorectal cancer
ssc05212  Pancreatic cancer
ssc05213  Endometrial cancer
ssc05214  Glioma
ssc05216  Thyroid cancer
ssc05217  Basal cell carcinoma
ssc05218  Melanoma
ssc05220  Chronic myeloid leukemia
ssc05222  Small cell lung cancer
ssc05223  Non-small cell lung cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    100518650 (POLK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100518650 (POLK)
   05202 Transcriptional misregulation in cancer
    100518650 (POLK)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100518650 (POLK)
   05212 Pancreatic cancer
    100518650 (POLK)
   05225 Hepatocellular carcinoma
    100518650 (POLK)
   05226 Gastric cancer
    100518650 (POLK)
   05214 Glioma
    100518650 (POLK)
   05216 Thyroid cancer
    100518650 (POLK)
   05220 Chronic myeloid leukemia
    100518650 (POLK)
   05217 Basal cell carcinoma
    100518650 (POLK)
   05218 Melanoma
    100518650 (POLK)
   05213 Endometrial cancer
    100518650 (POLK)
   05224 Breast cancer
    100518650 (POLK)
   05222 Small cell lung cancer
    100518650 (POLK)
   05223 Non-small cell lung cancer
    100518650 (POLK)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100518650 (POLK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ssc03400]
    100518650 (POLK)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     100518650 (POLK)
DNA repair and recombination proteins [BR:ssc03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    100518650 (POLK)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH ATP-cone
Other DBs
NCBI-GeneID: 100518650
NCBI-ProteinID: XP_020940112
Ensembl: ENSSSCG00000014082
LinkDB
Position
2
AA seq 878 aa
MDGTKEKNDSTKERNDNYKDDLLFRMGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNE
LKREKQVNQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEQSRDLSNTIVHIDMDAFYA
AVEMRDNPELRDKPIAVGSRNMLSTSNYHARKFGVRGAMPGFIAKRLCPQLIIVPPNFDK
YRAVSSEVKEIFADYDPNFMALSLDEAYLNITKHLEERQNWPEDKRKYFIKTGNSLENDK
PGKEVNKLSEHERSISPLLFEDSXPDLKSPGNSFQVNFEEPNNPQMTQNSVVFGTSAEEV
VKEIRFRIEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPNRQVVMDFIKDLPIRK
VSGIGKVTEKMLKALGIITCTDLYQQRALLSLLFSETSWHYFLHISLGLGSTCLPRDGER
KSMSVERTFSEINKAEEQYSLCQELCSELAQDLQKEGLKGRTVTLKLKNVDFEVKTRAST
VLSVISTAEEIFAIAKELLRTEIDADFPHPLRLRLMGVRLSSFPNEEEKKHQQRSIIGFL
QPGNQTLSATGCMLEKTDKDQFPKPLEMSHKKSFFDKKRSERKLSHQDTFKSEIVDRQSL
PTSQSFQVLKKKRSENLETLENSDNGQVFTCPVCFREQGSIGLEAFNKHVDACLDGPSVS
GNSKMSSCSHASSTEANQKEHVHDSISLFEKQDYRTHQKNTEITSVDSVELVETVSNPSN
AEGVDASSNKHSEEECSNLPSKSLHMEHHPQNPCTVALENDDVGSLGRQEPPQPYLYEVT
SDQVLVCPVCNLEQKTSDLTLFNVHVDVCLNKGIIQELRKDKVSPVNRPKDSTKTTDNPG
KVQKIGTKTKRPGLMTKYSASKKTKSNNPRHTIDIFFK
NT seq 2637 nt   +upstreamnt  +downstreamnt
atggatggcacaaaagagaagaatgacagcacaaaggaaaggaatgacaactacaaagat
gatcttctgtttaggatgggacttaatgataataaagctggaatggaaggattggataaa
gagaaaattaacaaaattataatggaggccacaaaggggtctagattttatggaaatgag
ctcaagagagaaaagcaagtcaaccaacgaattgaaaatatgatgcaacaaaaagctcag
attaccagccagcagctaaggaaagcacaattacaggttgacagatttgcaatggaattg
gaacagagccgggatctgagcaataccatagtgcacattgacatggatgctttctatgca
gccgtagaaatgagggacaatccagaactaagggataagcccattgctgtaggatcaagg
aatatgttgtctacttcgaattaccatgcaaggaagtttggtgttcgtggagccatgcca
ggatttattgctaaaagactctgccctcaactgattatagtgccccccaattttgacaaa
taccgagctgtgagtagcgaggttaaggaaatatttgctgattatgatcccaattttatg
gccctgagtcttgatgaagcctacttgaacataacaaagcacttagaggaaaggcaaaat
tggcctgaggacaaaaggaagtatttcatcaaaacagggaactctctagaaaatgataaa
ccaggaaaggaagttaataaactgagtgagcatgaacgatccatctctccactacttttt
gaagatagtnctcctgatttgaagtccccaggaaattcttttcaagtgaactttgaagag
ccgaataatcctcaaatgacccaaaactcagttgtttttggaacatcagctgaggaagtg
gtaaaggaaattcgtttcagaatcgagcaaaaaacaacactgacagccagtgcaggcatt
gcaccaaatacaatgttagcaaaagtctgcagtgataagaataaaccaaatggacaatac
caaattctccctaaccgacaggttgtgatggacttcatcaaggacttacccattagaaag
gtttctggaataggaaaagttacagagaaaatgttaaaggctcttggaattattacgtgt
acagatctctaccaacagagggcattactttctctccttttctctgaaacatcttggcat
tatttccttcatatttccctgggtctaggttcaacatgcttgcccagggatggagagagg
aaaagcatgagtgttgagaggacattcagtgagataaataaagcagaagagcagtacagc
ttgtgccaagaactttgcagtgaacttgctcaagatctgcagaaagaaggacttaagggt
agaactgttacccttaagctgaagaatgtggatttcgaagtaaaaactcgtgcatctaca
gttttatctgttatttctactgcagaagaaatatttgccattgctaaagaattgctaaga
acagaaattgatgctgattttccacatcccttgagattaagacttatgggtgtgcggcta
tctagttttcctaatgaagaagagaagaaacaccaacagagaagcattattggcttctta
cagcctggaaaccaaaccctgtcagccactgggtgtatgctagagaaaactgacaaagat
cagtttccaaaacctctggaaatgtctcataagaagagtttctttgataaaaaacgatct
gaaaggaaattgagccaccaagacacatttaagagtgaaattgtagacagacaaagttta
ccgacatcacaatcattccaagttttaaagaagaagaggagtgagaatttagaaacattg
gagaattcagataatggtcaggtatttacctgtcctgtttgctttagggagcaaggaagc
attggtctggaagcctttaataaacacgtagatgcatgtcttgatgggccttcagtgagt
ggaaactctaaaatgtcctcgtgttcacatgcttcctctacagaagcgaatcagaaagaa
catgtacatgattctatttcactctttgagaagcaggattacagaacccatcagaagaat
acagagatcacttcagtagattctgtggaactggtagagactgtcagtaacccatctaat
gcagagggtgtagatgcttcaagtaataaacacagtgaagaagaatgttctaatcttcca
agcaaatcacttcatatggaacatcatccgcagaatccttgtactgttgcactggaaaat
gacgatgttgggtcattaggaaggcaggaacccccccaaccttatttatatgaagtgacc
agtgaccaagttctagtttgtccggtttgtaatctagaacagaagacttcagatcttacc
ttgttcaatgtgcatgtggatgtttgcttaaacaaaggcattatccaggaactgagaaag
gataaagttagtccagttaacagacccaaagatagcaccaaaactactgataacccgggc
aaagtacagaagattggaacaaaaactaaaaggccaggattgatgacaaagtactcggca
tcaaagaaaacaaaatcaaacaatcccagacataccattgacatattttttaaatga

DBGET integrated database retrieval system