KEGG   Sus scrofa (pig): 100518733
Entry
100518733         CDS       T01009                                 

Gene name
CACNA1C
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent L-type calcium channel subunit alpha-1C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04010  MAPK signaling pathway
ssc04020  Calcium signaling pathway
ssc04022  cGMP-PKG signaling pathway
ssc04024  cAMP signaling pathway
ssc04260  Cardiac muscle contraction
ssc04261  Adrenergic signaling in cardiomyocytes
ssc04270  Vascular smooth muscle contraction
ssc04713  Circadian entrainment
ssc04720  Long-term potentiation
ssc04723  Retrograde endocannabinoid signaling
ssc04724  Glutamatergic synapse
ssc04725  Cholinergic synapse
ssc04726  Serotonergic synapse
ssc04727  GABAergic synapse
ssc04728  Dopaminergic synapse
ssc04742  Taste transduction
ssc04911  Insulin secretion
ssc04912  GnRH signaling pathway
ssc04921  Oxytocin signaling pathway
ssc04924  Renin secretion
ssc04925  Aldosterone synthesis and secretion
ssc04927  Cortisol synthesis and secretion
ssc04929  GnRH secretion
ssc04930  Type II diabetes mellitus
ssc04934  Cushing syndrome
ssc04935  Growth hormone synthesis, secretion and action
ssc05010  Alzheimer disease
ssc05020  Prion disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05031  Amphetamine addiction
ssc05410  Hypertrophic cardiomyopathy
ssc05412  Arrhythmogenic right ventricular cardiomyopathy
ssc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100518733 (CACNA1C)
   04020 Calcium signaling pathway
    100518733 (CACNA1C)
   04024 cAMP signaling pathway
    100518733 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    100518733 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100518733 (CACNA1C)
   04929 GnRH secretion
    100518733 (CACNA1C)
   04912 GnRH signaling pathway
    100518733 (CACNA1C)
   04921 Oxytocin signaling pathway
    100518733 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    100518733 (CACNA1C)
   04924 Renin secretion
    100518733 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    100518733 (CACNA1C)
   04927 Cortisol synthesis and secretion
    100518733 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100518733 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    100518733 (CACNA1C)
   04270 Vascular smooth muscle contraction
    100518733 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    100518733 (CACNA1C)
   04727 GABAergic synapse
    100518733 (CACNA1C)
   04725 Cholinergic synapse
    100518733 (CACNA1C)
   04728 Dopaminergic synapse
    100518733 (CACNA1C)
   04726 Serotonergic synapse
    100518733 (CACNA1C)
   04720 Long-term potentiation
    100518733 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    100518733 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    100518733 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100518733 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100518733 (CACNA1C)
   05020 Prion disease
    100518733 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    100518733 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    100518733 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100518733 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100518733 (CACNA1C)
   05414 Dilated cardiomyopathy
    100518733 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100518733 (CACNA1C)
   04934 Cushing syndrome
    100518733 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ssc04040]
    100518733 (CACNA1C)
Ion channels [BR:ssc04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100518733 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel DUF4834
Other DBs
NCBI-GeneID: 100518733
NCBI-ProteinID: XP_020948640
LinkDB
Position
5
AA seq 2165 aa
MVNENTRMYIPEENHQGPSYGSPRPAHANMNANAAAGLXPEHIPTPGAALSWQAAIDAAR
QAKLMGSGGNATISTVSSTQRKRQQYGKPKKQGSTTATRPPRALLCLTLKNPIRRACISI
VEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFR
VLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYN
QEGVPDVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGD
FQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPRNMSMPTSETESVNTENVA
GGDIEGESCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSSIFYWLVIFLVFLNTLT
IASEHYNQPRWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGI
LETILVETKVMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFL
FIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYG
GPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLAR
TASPEKKQEVVEKPAVEEXQEEKIELKSITADGESPPATKINMDDLQPNENEDKCSYPNP
ETAGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSPNNRFRLQCHRIVNDS
IFTNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKMTAYGAFLH
KGSFCRNYFNILDLLVVAVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQ
CVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGE
VDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRV
EISVFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLR
RYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKVAMNVLNMLFTG
LFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSVIDVILSETNHYFCDAWNTFDALIVV
GSIVDIAITEVNPAEHTQCSPFMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWT
FIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRC
ATGEAWQDIMLACMPGKKCAPESEPGNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFV
AVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGK
LCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKKI
WKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQ
AGLRTLHDLGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVGYYPS
DSRSAFPQTFTTQRPLHISKAGNSQGDTESPSHEKLVDSTFTPSSYSSTGSNANINNANN
TALGRCPHLAGHPSAVSTVEGRGPPLSPAVRVQEAAWRQSSKRHLSQESQLAMVCQEEAS
RDETCDVRANEDEEYGSEPSLISTEMLSYQDDESRQLTPPEEDRRDIRLSPKRGFLRSAS
LGRRASFHLECLKRQKNQGDVSQKTVLPLHLVHHQALAVAGLSPLLQRSHPPGTFPLPCT
TPPATPGPGWPLRPVPTLRLEGAESSEKLTSSFPSVHCGPRAGEPTPCGAGSGPRRARPV
SLTVPSPAGTRGRQFHGSASSLVEAVLISEGLGQFAQDPRFLEATTQELADACDMTIEEM
ESAADNILSGGAGQSPNGTLLPFANCRDPGPDRAGGAEDAAWAPGPEPRQGEDELLDSRA
FASSL
NT seq 6498 nt   +upstreamnt  +downstreamnt
atggtcaatgaaaacacgaggatgtacattccagaggaaaaccaccaaggacccagctat
gggagcccacgcccggctcacgccaacatgaacgccaacgccgccgccgggctgngcccc
gagcacatccccacaccgggggccgccctgtcctggcaggcagccatcgacgcagcccgg
caggccaagctgatgggcagtggcggcaacgcgaccatctcgacggtcagctccacacag
cggaagcggcagcagtacgggaagcccaagaagcagggcagcaccaccgccacccgcccg
ccccgggccctgctctgcctgactctgaagaaccccatccggagggcgtgcatcagcatt
gtcgagtggaagccatttgaaatcattattttactgaccatttttgccaattgcgtggcc
ttagcgatctatatcccctttccggaggatgactccaacgccaccaactccaacctggaa
cgagtggagtatctctttctcatcatttttactgtggaagcatttttaaaagtcatagcc
tatggactcctctttcaccccaacgcttacctccgcaacggctggaatttactagatttt
atcattgtggttgtcgggcttttcagtgcaatcttagagcaagccaccaaagccgacggg
gcgaatgctctcggcgggaaaggggctggattcgacgtgaaggcactgagggcgttccgt
gtgctgaggcccctgcggctggtgtccggggtcccaagcctccaggtggtcctgaactcc
attatcaaggccatggtccccctgctgcacatcgccctgctcgtgctctttgtcatcatc
atctacgccatcatcggcctggagctcttcatggggaagatgcacaagacctgctacaac
caggagggcgtcccagatgttccagcagaagacgacccctccccctgtgctctggagacg
ggccacgggcggcagtgccagaatggcacagtgtgcaagccaggctgggacgggcccaag
cacggcatcaccaacttcgacaactttgccttcgccatgctgaccgtgttccagtgcatc
accatggagggctggaccgacgtgctctactgggtcaatgatgccgtgggaagggactgg
ccctggatctattttgttacactaatcatcatagggtcattttttgtacttaacttggtt
ctcggtgtccttagcggagagttttccaaagagagggagaaggccaaggcacggggcgac
ttccagaagctgcgggagaagcagcagctggaagaggacctgaaaggctacctggactgg
atcactcaggccgaagacatcgaccccgagaacgaggatgagggcatggacgaggagaag
ccccgaaacatgagcatgcccaccagtgagaccgagtctgtcaacacggaaaacgtggct
ggaggtgacatcgagggagaaagctgcggggccaggctggcccaccggatctccaaatcg
aagttcagccgctactggcgcaggtggaaccgcttctgcagaaggaagtgccgcgcagcc
gtgaagtcgagcatcttctactggctggtcatcttcctggtgttcctcaacacgctcacc
atcgcctccgagcactacaaccagccccgctggctcacggaagtgcaagacacggccaac
aaggccctgctggccctgttcacggcggagatgctgctcaagatgtacagcctggggctg
caagcctactttgtgtccctgttcaaccgcttcgactgcttcatcgtgtgcggtggcatc
ctggagaccatcctggtggagaccaaggtcatgtcgccgctgggcatctccgtgctcaga
tgcgtccgcctcctgaggatcttcaagatcacacggtactggaactccctgagcaacctg
gtggcatccttgctgaactccgtgcgctccatcgcctccctgctgctgctcctcttcctc
ttcatcatcatcttctccctcctggggatgcagctctttggggggaagttcaactttgat
gagatgcagacccggaggagcacatttgataactttccccagtccctgctcaccgtgttt
cagatcctgaccggggaggactggaattcggtgatgtatgatgggatcatggcttatggc
ggcccctcttttccagggatgttagtctgtatttacttcatcatcctcttcatctgtgga
aattatatcctactgaacgtgttcttggccattgccgtggacaacctggcggatgctgag
agcctcacctctgcccagaaggaggaggaagaggagaaggagagaaagaagctggccagg
actgccagcccagagaagaagcaagaggttgtggagaagccagcagtggaggagnaccaa
gaggagaaaatcgagctgaagtccatcacggcagacggagagtccccgcccgccaccaag
atcaacatggacgacctccagcccaacgaaaatgaggacaagtgttcctaccccaaccca
gaaactgcaggagaagaggacgaggaggagcctgagatgcccgtgggcccgcgcccccgc
cccctctccgagctgcacctgaaagagaaggcggtgcccatgccagaagccagtgccttc
ttcatcttcagccccaataacaggttccgcctccagtgtcatcgcatcgtcaatgactcc
atcttcaccaacctgatcctcttcttcatcctgctcagcagcatctcgctggccgccgag
gaccccgtgcagcacacctccttcaggaaccacattctgttttattttgacattgttttc
actaccattttcaccattgaaattgctctgaagatgactgcctatggggccttcctgcac
aagggctccttctgccgcaactacttcaacatcctggacctgctggtggtggccgtgtcc
ctcatctccttcggcatccagtccagcgccatcaatgtggtgaagatcttgcgggttctg
agggtgctcaggcccctgagggccatcaacagggccaaggggctgaagcacgtggtgcag
tgcgtgtttgtggccatccgcaccatcgggaacatcgtgatcgtgaccacgctgctccag
ttcatgttcgcctgcatcggggtccagctcttcaagggaaagctctacacctgttcagat
agttccaagcagacggaggccgaatgcaaggggaactacatcacatacaaggacggggag
gttgaccaccccatcatccagccccgcagctgggagaacagcaagttcgactttgacaat
gtcctggcggccatgatggccctgttcaccgtctccacctttgaggggtggccagagctg
ctctaccgctccatcgactcccacacggaggacaaaggccccatctacaactaccgcgta
gagatctccgtcttcttcatcatctacatcatcatcatcgccttcttcatgatgaacatc
ttcgtgggcttcgtcatcgtcaccttccaggagcagggcgagcaggagtacaagaactgc
gagctggacaagaaccagcggcagtgcgtggagtacgccctcaaggcccggcccctgcgg
aggtacatccccaagaaccagcaccagtacaaggtgtggtacgtggtcaactccacctac
tttgagtacctgatgttcgtcctcatcctgctcaacaccatctgtctggccatgcagcac
tacgggcagagctgcctgttcaaggtcgccatgaacgtcctcaacatgctcttcaccggc
ctcttcacggtcgagatgatcctgaagctcatcgccttcaagcccaagggctactttagt
gacccctggaatgtctttgacttcctcatcgtaattggcagcgtaattgacgtcattctc
agtgagaccaatcactatttctgtgatgcatggaacacatttgacgccttgattgttgtg
ggtagcattgttgatatagcgatcaccgaggtaaacccagctgaacatacgcagtgctct
ccctttatgaacgcggaggagaactcccgcatctccatcaccttcttccgcctcttccgg
gtcatgcgtctggtcaagctgctgagccgcggggagggcatccggaccctgctgtggacc
ttcatcaagtccttccaggccctgccctacgtggctctcctgatcgtgatgctgttcttc
atctacgccgtgattgggatgcaggtctttgggaaaattgccctgaatgacacgacggag
atcaaccggaacaacaacttccagaccttcccccaggccgtgctgctcctcttcaggtgt
gccacaggggaggcatggcaggacatcatgctggcctgcatgccagggaagaagtgcgcc
cccgagtcagagcccggcaacagcacggagggggagacaccctgtggcagcagcttcgcc
gtcttctatttcatcagcttctacatgctctgtgccttcctgatcatcaacctctttgtg
gcagtcatcatggacaactttgactacctgaccagggactggtccatcctgggtccccac
catctggatgaatttaagagaatctgggcggagtatgaccctgaagccaagggtcgcatc
aaacacctggatgtggtaaccctgctccggcggatccagcccccgctgggcttcgggaag
ctgtgccctcaccgcgtggcttgcaaacgactggtgtccatgaacatgcccctgaacagc
gacgggaccgtcatgttcaacgccaccctgtttgcccttgtccggacggccctgaggatc
aaaacagaagggaacctggaacaggccaatgaggagctgcgggccataatcaagaagatc
tggaagcggaccagcatgaagctgctagaccaggtggtgccccccgccggagacgatgag
gtcacggttggcaagttttacgctacgttcctgatccaagagtacttccggaaattcaag
aagcgcaaagagcagggcctcgtggggaagccctcccagaggaacgccctgtccctgcag
gctggcctgcgcaccctgcacgacctcgggcccgagatccgaagagccatctctggggac
ctgacggcggaggaagagctggacaaggccatgaaggaggccgtgtccgcggcctccgaa
gacgacatcttcaggagggccggcggcctgtttggcaaccatgtgggctactatccaagc
gacagtcggagcgccttcccccagaccttcaccacccagcgccctctgcacatcagcaaa
gcggggaacagccagggtgacacggagtcgccctcccacgagaagctggtggactccacc
ttcacccccagtagctactcatccacaggctccaatgccaacatcaacaatgccaacaac
accgccctgggccgctgcccccacctggctggccaccccagtgcggtcagcaccgtggag
ggccgagggccccccttgtcccccgccgtccgggtacaggaggctgcatggaggcaaagc
tccaagaggcacctctcccaggagagccagctagccatggtgtgtcaggaggaggcctct
cgggacgagacctgtgacgtgagggcgaatgaggacgaggagtacggcagcgagcccagc
ctgatctccacagagatgctgtcctatcaggacgacgaaagccggcagctgacacctcct
gaggaggacaggagagacatcaggctctctccgaagaggggcttcctgcgctccgcctcc
ctgggccgacgggcctccttccaccttgagtgtctgaaacgacagaagaatcaaggggac
gtctctcagaagacagtcctgcccctgcatctggttcaccatcaggctttggcggtggca
ggcctgagccccctcctgcagagaagccatcctcccggcaccttccccctgccatgcacc
acgccccccgccacacctggcccaggctggcctctgaggcctgtccccaccctgcggctg
gagggggccgagtccagcgaaaagctcaccagcagcttcccgtccgtccattgcggcccc
cgggctggggagcccacgccctgcggggcaggcagtggcccccggagggcccggccggtg
tctctcactgtgcccagcccagcagggacccggggccgacagttccacggcagcgccagc
agcctggtggaagcggtcttgatctcagaaggactggggcagtttgctcaggatcccagg
ttcttggaggccaccacccaggagctggccgacgcctgcgacatgaccatagaggagatg
gagagcgccgccgacaacatcctcagcgggggcgctgggcagagccccaacggcaccctg
ctcccctttgcaaactgcagggacccagggccggaccgagcagggggcgcggaggacgcg
gcctgggcgcccggccccgagccccgccagggcgaggacgagctcctggacagcagggcc
ttcgccagcagcctgtag

DBGET integrated database retrieval system