KEGG   Sus scrofa (pig): 100518913
Entry
100518913         CDS       T01009                                 

Gene name
CASP9
Definition
(RefSeq) caspase-9 isoform X1
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01524  Platinum drug resistance
ssc04115  p53 signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04210  Apoptosis
ssc04215  Apoptosis - multiple species
ssc04370  VEGF signaling pathway
ssc04919  Thyroid hormone signaling pathway
ssc05010  Alzheimer disease
ssc05012  Parkinson disease
ssc05014  Amyotrophic lateral sclerosis
ssc05016  Huntington disease
ssc05020  Prion disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05134  Legionellosis
ssc05145  Toxoplasmosis
ssc05152  Tuberculosis
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05162  Measles
ssc05163  Human cytomegalovirus infection
ssc05164  Influenza A
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05168  Herpes simplex virus 1 infection
ssc05169  Epstein-Barr virus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05200  Pathways in cancer
ssc05210  Colorectal cancer
ssc05212  Pancreatic cancer
ssc05213  Endometrial cancer
ssc05215  Prostate cancer
ssc05222  Small cell lung cancer
ssc05223  Non-small cell lung cancer
ssc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100518913 (CASP9)
   04151 PI3K-Akt signaling pathway
    100518913 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100518913 (CASP9)
   04215 Apoptosis - multiple species
    100518913 (CASP9)
   04115 p53 signaling pathway
    100518913 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100518913 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100518913 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100518913 (CASP9)
   05212 Pancreatic cancer
    100518913 (CASP9)
   05215 Prostate cancer
    100518913 (CASP9)
   05213 Endometrial cancer
    100518913 (CASP9)
   05222 Small cell lung cancer
    100518913 (CASP9)
   05223 Non-small cell lung cancer
    100518913 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100518913 (CASP9)
   05012 Parkinson disease
    100518913 (CASP9)
   05014 Amyotrophic lateral sclerosis
    100518913 (CASP9)
   05016 Huntington disease
    100518913 (CASP9)
   05020 Prion disease
    100518913 (CASP9)
   05022 Pathways of neurodegeneration - multiple diseases
    100518913 (CASP9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100518913 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100518913 (CASP9)
   05152 Tuberculosis
    100518913 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100518913 (CASP9)
   05161 Hepatitis B
    100518913 (CASP9)
   05160 Hepatitis C
    100518913 (CASP9)
   05164 Influenza A
    100518913 (CASP9)
   05162 Measles
    100518913 (CASP9)
   05168 Herpes simplex virus 1 infection
    100518913 (CASP9)
   05163 Human cytomegalovirus infection
    100518913 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100518913 (CASP9)
   05169 Epstein-Barr virus infection
    100518913 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100518913 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100518913 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ssc01009]
    100518913 (CASP9)
   01002 Peptidases and inhibitors [BR:ssc01002]
    100518913 (CASP9)
Enzymes [BR:ssc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     100518913 (CASP9)
Protein phosphatases and associated proteins [BR:ssc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100518913 (CASP9)
Peptidases and inhibitors [BR:ssc01002]
 Cysteine peptidases
  Family C14: caspase family
   100518913 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 100518913
NCBI-ProteinID: XP_003127666
Ensembl: ENSSSCG00000003460
UniProt: F1SUV9 A0A4X1W1Y9
LinkDB
Position
6
AA seq 438 aa
MDEADRQVLRHCRVRLVRELQVASLWDALLNRELFTPDMIEDIQRAGSGSRRDQARQLIT
DLETRGSQALPVFISCLEDTGQETLASLLRTSRQATKRDLGAIRPLDLHPVVIKPVELKP
EEPSKPPPGKLAPVVLGSKNLWPARPEAPRPVDIGSGGFSDVCGPDRAKGNADLAYVLNA
DPCGHCLIINNVNFCHESGLRKRTGSNIDCERMQRRFHLLHFVVDVKCNLTAKQMVQALV
ELARRDHGALDCCVVVVLSHGCQASHLQFPGAVYGTDGCPVSVEKIVNIFNGTSCPSLGG
KPKLFFIQACGGEQKDHGFEVASPSPEDRTADSNPEPDAAPFQEGPGAVDQPDAVSSLPT
PSDILVSYSTFPGFVSWRDTTSGSWYIETLDGVLEQWAHCEDLLTLLLRVSNAVSVKGIY
KQIPGCFNFLRKKLFFKT
NT seq 1317 nt   +upstreamnt  +downstreamnt
atggacgaggctgaccggcaggtcctgcggcattgtcgggtgaggctggtccgcgagctg
caggtggcctcgctctgggatgctctgctgaaccgtgagcttttcacccctgacatgatc
gaggacatccagcgggcaggctccgggtctcgcagagatcaggccaggcagctgatcaca
gatctagagactcgagggagtcaggcccttcctgtgttcatctcctgcttagaggacaca
ggccaggaaactctggcttcattactgagaaccagtagacaagcaacaaagcgggatctg
ggggccatcagacccctggacctccatcctgtggtgatcaaaccagtggaactcaagcca
gaggagccatcgaagcctcccccaggaaaacttgctccagtggtgctggggtctaagaac
ctttggccagccagaccagaggcacccaggccagtggacattggttctggaggattcagt
gatgtctgtggtccagacagagccaagggaaatgccgatttggcttacgtcctgaatgca
gacccctgtggccactgcctcatcatcaacaacgtgaacttctgccatgagtcggggctc
aggaagcgcactggctccaatatcgactgtgagaggatgcagcggcgcttccacttgctg
catttcgtggtggacgtgaagtgcaacctgactgccaagcaaatggtccaggctttggtg
gagctggcgcggcgggaccacggcgctctggactgctgcgtggtggtcgtgctctctcac
ggctgtcaggccagccacctccagttcccaggggctgtttatggcacagatggatgtcct
gtgtccgtggagaaaattgtgaacatcttcaacggaaccagctgccccagcctgggaggg
aagcccaagctcttcttcatccaggcctgcggcggggaacagaaagaccatgggtttgag
gtggcctccccgtcccctgaagacaggaccgccgacagtaaccctgagccagacgctgcc
ccgttccaggaaggcccgggcgccgttgaccagccggacgccgtgtccagtctgcccaca
cctagtgacatcttggtgtcctactccaccttccccgggtttgtctcctggagggatacc
acgagcggctcctggtacattgagaccctggatggcgttctggagcagtgggcccactgt
gaggacctgctgaccctcctgctcagggtctccaatgctgtctcagtgaaagggatttac
aagcagattcctggctgttttaatttcctccggaaaaagcttttcttcaaaacataa

DBGET integrated database retrieval system