KEGG   Sus scrofa (pig): 100520325
Entry
100520325         CDS       T01009                                 

Gene name
ZEB1
Definition
(RefSeq) LOW QUALITY PROTEIN: zinc finger E-box-binding homeobox 1
  KO
K09299  zinc finger homeobox protein 1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc05202  Transcriptional misregulation in cancer
ssc05206  MicroRNAs in cancer
ssc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100520325 (ZEB1)
   05206 MicroRNAs in cancer
    100520325 (ZEB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100520325 (ZEB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ssc03000]
    100520325 (ZEB1)
Transcription factors [BR:ssc03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, AbdB
    100520325 (ZEB1)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-Di19 zf-met zf-C2H2_jaz Homeodomain zf-C2H2_6 zinc_ribbon_15 zf-C2HE DZR
Other DBs
NCBI-GeneID: 100520325
NCBI-ProteinID: XP_020919855
LinkDB
Position
10
AA seq 1129 aa
MADGPRCKRRKQANPRRNNVTNYNTVVETNSDSDDEDKLHIVEEESITDAADCEGGVPED
DLPADQTVLPGSSAREGSAKSCWEDNAGKEGQEILGPEARAEEVGCTVKDDECDSDAENE
QNHDPNVEEFLQQQDTAVIYPEAPEEDQRQGTPEASGHDENGTPDAFSQLLTCPYCDRGY
KRFTSLKEHIKYRHEKNEDNFSCSLCSYTFAYRTQLERHMTSHKSGRDQRHVTQSGGNRK
FKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISLMPVN
GRPRAGLKTSQCSSPSLSASPGSPTRPQIRQKLENKPLQEQLSVNQIKTEPVDYEFKPIV
VASGINCSTPLQNGVFSGGGPLQATNSPQGVVQAVVLPTVGLVSPISINLSDIQNVLKVA
VDGNVIRQVLENNQANLASKEQETINASSIQQGGHSVISAISLPLVDQDGTTKIIINYSL
EQPSQLQVVPQNLKKETPVPTNSCKSEKLPEDLTVKSEKDKSFEGGGRNDSTCLLCDDRP
GDASALAELKHCDLRQPAQPPPLPAPEADKPEASDPSGSGEGGLSPSRPPLKNLLSLLKA
YYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQVSVQPSEPSSPEPGRANLPAKS
DDQPPPPDADEPQDSTGHQQSPLKITSSPVLPVGSAVNGSRSSTXPPSPLNLSSSRNTQG
YLYTAEGAAEEPQVEPLDLSLPKQQGELLERSTITSVYQNSVYSVQEEPLNLSCAKKEPQ
KDSCGTDSEPVVNVIPPSANPINIAIPTVTAQLPTIVAIAGQNSVPCLRALAANKQAVLI
PQVAYTYSTAVSPAVQDAPLKVIPPNGNQDERQDTSSEGVSNVEEQNDSDSTPPKKKMRK
TENGMYACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICKKAFKHKHHLIEHMRLHSGEK
PYQCDKCGKRFSHSGSYSQHMNHRYSYCKREAEERDAGPEDAGPGLAEHEHAGARASPSQ
GDSDERESSTREEDEDSDKEEEEEEREMEELQEEKGSGEPGGEEEEEEEEEEEMEEEEEQ
ETEEQEEGGRAKTAGATAEREGAGSPESSLEHKVSEGSEQVSEEKTNEA
NT seq 3390 nt   +upstreamnt  +downstreamnt
atggcggatggccccaggtgtaagcgcagaaagcaggcgaacccgcggcgcaataacgtt
acaaactataatactgtggtagaaacaaattcagattcagacgatgaagacaaactccat
attgtggaagaagaaagtattacggatgcagcagattgtgaaggtggtgtgccagaagat
gacctgccagcagaccagacagtgttacccgggagcagtgcaagagaagggagcgccaag
agctgctgggaggacaatgcagggaaggaaggacaagaaatcctggggcctgaagcccgg
gccgaggaagtgggatgtacagtaaaagatgacgaatgcgactcagatgcagaaaatgaa
caaaaccatgatcctaatgttgaagagtttctgcaacaacaagatacggctgtcatctac
cctgaggcacctgaagaggaccagaggcagggcacgccagaggccagcgggcacgatgaa
aatgggacgccagatgcattttcccagttactcacctgcccttattgtgacagaggatat
aagcgctttacctctttgaaagaacacattaaatatcgccacgagaagaacgaagataac
ttcagctgctccctgtgcagttacacctttgcatacagaacccaacttgaacgtcacatg
acctcccataaatcaggaagagatcagagacatgtgacgcagtctgggggtaatcgtaaa
ttcaagtgcactgagtgtggaaaagctttcaaatacaaacaccatctcaaagagcactta
agaatccacagtggagagaagccatatgaatgcccaaactgcaagaaacgtttttcccat
tctggttcctacagctcccacatcagcagtaagaagtgcatcagcctgatgcctgtgaac
gggcgacccagagcagggctcaagacctcgcagtgttcctccccttccctctcggcatcc
ccgggcagtcccacccgaccacagatacggcaaaagctagagaataaaccccttcaagaa
caactttccgtaaaccaaattaaaactgaacctgtggattatgaattcaaacccatagtg
gttgcttcaggaatcaactgttcaaccccattacaaaacggggtttttagtggtggtggc
cccttacaggcaaccaactctcctcagggtgtggtgcaggccgttgttctgccgacagtg
ggtttggtgtctcccataagtatcaatttaagtgatattcagaatgtacttaaagtggca
gtagatggtaatgtaataaggcaagttttggagaataatcaagccaatcttgcatccaaa
gaacaagaaacaatcaatgcttcatccattcagcaaggtggccattctgttatttcagcc
atcagtcttcctttggttgatcaagatggaacaaccaaaattatcattaactacagtctt
gaacagcctagccaacttcaagttgttcctcagaatttaaaaaaagaaactccagtcccc
acaaacagttgcaaaagtgaaaagttaccagaagatcttactgttaaatctgagaaggac
aaaagctttgagggaggaggaaggaacgacagcacctgccttctgtgtgacgaccgccca
ggggacgccagcgcactggcagagctgaagcactgtgacctgaggcagcccgcccagccc
ccgccactcccagccccggaggctgacaagcccgaggcctcggacccctcgggctccgga
gagggcggtttgtccccgagtcggccacctctaaagaacctcttgtctcttctcaaggca
tattatgctctgaacgctcagccaagtgcagaggagctctccaaaattgccgactcagtg
aaccttccactggacgtagtgaaaaagtggtttgaaaagatgcaggccggacaggtttcc
gtgcagccttctgaaccgtcttctcctgaaccgggcagagccaacctccctgcaaagagc
gacgatcagcctccaccaccagatgcagacgaaccccaggacagcacgggacaccaacag
agtccactgaagataaccagctcccccgttttaccagtggggtcagccgtcaatggctcc
agaagtagtacantccccccctcccctctcaacctttcctcatccagaaacacacagggt
tacttgtacacggcagagggcgcagccgaagagccccaagtagaacctctggatctttca
ctaccaaagcagcagggagagttactggagaggtccactatcactagtgtttaccagaac
agtgtttattctgtccaggaggagcccttgaacttgtcttgtgcaaaaaaggagccacaa
aaggacagttgtggtacagactcagaaccagttgtaaatgtaatcccaccaagtgccaac
cccataaacattgctatacctacagtcactgcccagttacccaccatcgtggccattgcc
ggccagaacagtgtcccgtgcttgcgagcgctagctgccaacaagcaggccgtcctcatc
ccccaggtggcatacacatactcgacggccgtcagccccgcggtccaggacgcacccctg
aaagtgatcccgccaaatggaaatcaggatgaaaggcaagacaccagctcggaaggagta
tccaacgtggaggagcagaatgactcggattccacaccacccaaaaagaagatgcgaaag
acagaaaacggaatgtatgcctgcgatttgtgtgacaagattttccaaaagagtagctca
ctgttgagacataaatatgaacacacaggtaaaagacctcatgagtgtggcatctgcaaa
aaggccttcaaacacaagcatcacttgatcgaacacatgcgcttgcattctggagagaag
ccctaccaatgtgacaagtgcgggaagcgcttctcgcactcgggctcctactcccagcac
atgaaccaccgctactcctactgcaagcgggaggcagaggagcgggacgcaggccccgag
gacgcaggcccgggcctggccgagcacgagcacgcgggggcccgcgcatccccatcacag
ggcgactcggacgagagggagagctcgacgcgggaagaggatgaagacagcgacaaggag
gaagaggaggaggagagagagatggaggaactgcaggaggaaaagggaagtggagaaccc
ggaggagaggaggaggaggaggaggaagaggaagaggagatggaggaggaggaggagcag
gagacggaggagcaggaggagggaggcagagccaagaccgcaggtgcgacagcggagagg
gaaggcgctggaagtccagagagcagcctagaacacaaagtgagcgagggtagtgagcag
gtgtcggaagaaaagacaaatgaagcctaa

DBGET integrated database retrieval system