KEGG   Sus scrofa (pig): 100520434Help
Entry
100520434         CDS       T01009                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc03030  DNA replication
ssc03410  Base excision repair
ssc03420  Nucleotide excision repair
ssc03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100520434 (LIG1)
   03410 Base excision repair
    100520434 (LIG1)
   03420 Nucleotide excision repair
    100520434 (LIG1)
   03430 Mismatch repair
    100520434 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ssc03032]
    100520434 (LIG1)
   03400 DNA repair and recombination proteins [BR:ssc03400]
    100520434 (LIG1)
Enzymes [BR:ssc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100520434 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     100520434 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     100520434 (LIG1)
DNA replication proteins [BR:ssc03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    100520434 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     100520434 (LIG1)
DNA repair and recombination proteins [BR:ssc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     100520434 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     100520434 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     100520434 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C PucR
Motif
Other DBs
NCBI-GeneID: 100520434
NCBI-ProteinID: XP_020950308
Ensembl: ENSSSCG00000003128
LinkDB All DBs
Position
6
AA seq 923 aa AA seqDB search
MQRSIMSFFQPKEEGKAKKPEKETSNSTREIESPPKVALKERNRVVPEGDSPVRRPGRKV
ARVLGSEGEDEEDASTPPKRQKLAPDSPQVSHPGPVSFPESSPSLSSSSPEVISPSGIPK
RRTARKQLSKRTFQDVLEEQSEDKDREAKRPKTEEEAETPTESLTEPEVSKKQEAEEGDQ
PTTPPEPPKTATESPAVAVAVAASISGPEVAAKQAVQEDGQAKPPPRTLKTLSSFFSPRK
PAAKKEVNEEGPSALRKDEATGHPDPPSYNPAKNNYHPVQDACWQAGQRVPYLAVARTFE
KIEEVSARLRMVETLSNLLRSVVALSPADLLPVLYLSLNRLGPPQQGLELGIGDGILLKA
VAQATGRQLESVRAEVAEKGDVGLVAESSRSTQRLVLPPPALTAAGVFTKFRDIAQLAGS
ASTAKKMEIIKGLFVACRHSEARFIARALSGRLRLGLAEQSVLAALAQAASLTPPGQGEI
PPAMVDAGKGKTAEARKTWLEEQGMILKQTFCEVPDLDRIVPVLLEHGLERLPEHCRLSP
GVPLKPMLAHPTRGVSEVLKRFEEAAFTCEYKYDGQRAQIHVLEGGEVKIFSRNQEDNTG
RYPDIISRIPKIKLPSVTSFILDAEAVAWDREKKQIQPFQVLTTRKRKEVDAAEIQVQVC
LYAFDLIYLNGESLVREPLSRRRQLLRENFVETEGEFVFATSLDTKDTDQIAEFLEQSVK
DSCEGLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVSDTLDLVVIGAYLGRGKRAGRYG
GFLLASYDEESEELQAICKLGTGFSDEELEAHHQSLQALVLPAPRSYVRADGAVAPDHWL
DPSAVWEVKCADLSLSPIYPAARGLVDSEKGISLRFPRFIRVRDDKKPEEATTSAQVACL
YRKQSQIQNQQGTGPDSDQEDFY
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagtatcatgtcatttttccagcccaaggaagagggcaaagcaaagaagcca
gagaaggagacatccaacagtaccagagaaatagagtcccctccaaaggtggcactgaag
gagcggaatagagtggtgcccgagggcgactctccagtaaggaggcctgggaggaaggtg
gcccgggtgctgggcagcgaaggggaggatgaggaggacgcctccacgccccccaaacgc
cagaaacttgctccagactctccacaagtctcccatcccggtcctgtctcttttcctgag
agcagcccttccctctccagctcctctccggaggtcatctccccatcagggatcccgaag
cgtcgcacagcccggaagcagctgtccaaacggacatttcaggatgtcctggaagagcag
agcgaggacaaggacagagaagctaagaggccgaagacggaagaagaagccgagacacca
acagaaagcctcacagagcctgaagtgagcaaaaagcaggaagcagaagaaggggaccag
cccacaacgccccctgagcccccaaagactgccacagagtccccggcggtagcggtggcg
gtggcagcaagcatctcggggcccgaggtggcggcgaagcaggcagtgcaggaggatggc
caggcgaagcctccccccagaactctcaagacgctcagcagtttcttctccccccggaag
ccggcagctaaaaaagaagtgaacgaagagggacccagcgccctacgaaaggacgaggcc
acgggacacccggaccctcccagctacaatcctgccaagaacaactaccatcccgtccag
gatgcctgctggcaggcgggccagagggtcccctacctggccgtggcccggacctttgag
aagattgaggaggtttctgcacggctccgcatggtcgagacgctgagcaacctgctgcgc
tccgtggtggccctgtcacctgcggacctcctccccgtcctctacctcagcctcaaccgc
ctggggccgccccagcagggcctggagctcggcatcggcgacggcatccttctcaaggca
gtggcccaggccacaggtcggcagctcgagtcagtccgggctgaggtggccgagaagggc
gacgtggggctggtggccgagagcagccgaagcacccaaaggctcgtgctgcccccgccc
gccctcaccgctgccggcgtcttcaccaagttccgggatatcgcgcagctggcgggcagc
gcgtccacagccaagaagatggaaatcatcaaaggcctctttgtggcctgtcgccactca
gaagcgcgattcatcgccagagccctgagtggacggctgcgcctcgggctggctgagcag
tcggtgctggcggccctcgcccaggccgcgagcctcacgcccccaggccaaggtgaaatt
ccccccgccatggtggatgctgggaagggcaagacagcagaagccaggaagacgtggctg
gaggagcagggcatgatcctgaaacagacgttctgcgaggtgcccgacctggaccggatc
gtccctgtgctgctggagcacggcctggaacgtctaccggagcactgcaggctgagccca
ggggtccccctgaaaccaatgctggcgcaccccacgcggggcgtcagcgaggtcctgaaa
cgctttgaggaggcagctttcacctgcgagtacaaatacgatgggcagagagcacagatc
cacgttctggaaggcggcgaggtgaagatcttcagcaggaaccaggaagacaacaccgga
aggtaccccgacatcatcagccgcatccccaagattaaactcccatccgtcacatccttc
attctggatgcggaagccgtggcttgggaccgggaaaagaagcagatccagccattccaa
gtgctcaccacccgcaaacgcaaggaggtggacgcggcagagatccaggtgcaggtgtgt
ctctacgccttcgacctcatctacctcaacggagagtccctggttcgggagcccctttcc
cgacggcggcagctgctccgggagaacttcgtggagacggagggcgagtttgtcttcgcc
acctccctggacaccaaggacacggaccagatcgccgagttcctggagcagtcagtgaaa
gactcctgcgagggcctgatggtgaagaccctggatgtcgatgccacctacgagatcgcc
aagaggtcgcacaactggctcaagctgaagaaggactaccttgatggcgtgagcgacacc
ctggacctggtggtgatcggcgcctacctaggccggggaaagagggccggtcggtacggg
ggcttcctgctggcctcctatgatgaggagagtgaggagctgcaggccatatgcaagctc
ggaactggcttcagcgacgaggagctggaggcgcatcaccagagcctccaggccctggtg
ctgcccgccccccgctcctacgttcgcgccgacggggctgtggcccccgaccactggctg
gaccccagcgccgtgtgggaggtgaagtgcgccgacctctccctctcccccatctacccc
gccgcccggggcctggtggacagcgagaagggcatctcccttcgcttccctcggtttatt
cgagtccgtgacgacaagaagccggaagaggccaccaccagcgctcaggtggcctgtctg
taccggaaacaaagtcagattcagaaccagcaaggcacagggcccgactccgaccaggaa
gatttctactag

DBGET integrated database retrieval system